Home » PPAN » PPAN Antibodies » PPAN Antibody
Novus Biologicals products are now on bio-techne.com

PPAN Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: PPAN Antibody [NBP1-88525] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Western Blot: PPAN Antibody [NBP1-88525] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: PPAN Antibody [NBP1-88525] - Staining of human oral mucosa shows strong nucleolar positivity in squamous epithelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

PPAN Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RWEMDRGRGRLCDQKFPKTKDKSQGAQARRGPRGASRDGG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
PPAN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
PPAN Protein (NBP1-88525PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for PPAN Antibody

  • Brix domain-containing protein 3
  • homolog of S. cerevisiae SSF1
  • MGC14226
  • MGC45852
  • peter pan (Drosophila) homolog
  • peter pan homolog (Drosophila)
  • Peter Pan homolog
  • second-step splicing factor 1
  • SSF
  • Ssf-1
  • SSF1BXDC3SSF-1
  • SSF2
  • suppressor of sterile four 1
  • suppressor of SWI4 1 homolog

Background

PPAN is encoded by this gene is an evolutionarily conserved protein similar to yeast SSF1 as well as to the gene product of the Drosophila gene peter pan (ppan). SSF1 is known to be involved in the second step of mRNA splicing. Both SSF1 and ppan are essential for cell growth and proliferation. This gene was found to cotranscript with P2RY11/P2Y(11), an immediate downstream gene on the chromosome that encodes a ATP receptor. The chimeric transcripts of this gene and P2RY11 were found to be ubiquitously present and regulated during granulocytic differentiation. Exogenous expression of this gene was reported to reduce the anchorage-independent growth of some tumor cells. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

SNRPF Antibody -
Azide and BSA Free
NBP2-93854
Western Blot SNRPF Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin SNRPF Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin SNRPF Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
SHF Antibody
NBP2-56117
Immunocytochemistry/ Immunofluorescence SHF Antibody
Species: Hu
Applications: ICC/IF
Pancreatic Amylase
Alpha Antibody (OTI6D ...
NBP1-47659
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
Immunohistochemistry-Paraffin Pancreatic Amylase Alpha Antibody (OTI6D4)
(1 Review)
Species: Hu
Applications: IHC, IHC-P, WB
Ceruloplasmin
Antibody (6C3K9)
NBP3-15868
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry-Paraffin Ceruloplasmin Antibody (6C3K9)
Immunohistochemistry Ceruloplasmin Antibody (6C3K9)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(71 Publications)
Species: Hu
Applications: ELISA
Thymidylate
Synthase Antibody (HL ...
NBP3-25721
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Immunohistochemistry-Paraffin Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Thromboxane
synthase Antibody (OT
NBP2-02710
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
Flow Cytometry Thromboxane synthase Antibody (OTI2C1)
(1 Publication)
Species: Hu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Cav1.2 Antibody
(S57)
NBP1-22439
Immunocytochemistry/ Immunofluorescence Cav1.2 Antibody (S57)
Western Blot Cav1.2 Antibody (S57)
Immunohistochemistry Cav1.2 Antibody (S57)
(3 Publications)
Species: Ha, Hu, Mu, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, IP, MiAr, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
MHC Class I
Antibody (OX18) - BSA
NB120-6405
Flow Cytometry MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
Immunocytochemistry/ Immunofluorescence MHC Class I Antibody (OX18) - BSA Free
(37 Publications)
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
Placental
Lactogen/CSH1 Antibod ...
NBP2-46376
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Immunohistochemistry Placental Lactogen/CSH1 Antibody (OTI2G4)
Species: Hu
Applications: IHC, IHC-P, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
Recombinant Human
ARSH GST (N-Term) Pro ...
H00347527-P01
Other Recombinant Human ARSH GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, WB
Elastin Antibody
(BA-4)
NB100-2076
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
Immunohistochemistry-Paraffin Elastin Antibody (BA-4)
(2 Reviews)
(11 Publications)
Species: Bv, Fe, Hu, Rb
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
GRB2 Antibody
[Unconjugated]
AF3846
Western Blot GRB2 Antibody [Unconjugated]
Immunohistochemistry GRB2 Antibody [Unconjugated]
(2 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
SUCLG2 Antibody
NBP1-32521
Immunocytochemistry/ Immunofluorescence SUCLG2 Antibody
Western Blot SUCLG2 Antibody
Immunohistochemistry-Paraffin SUCLG2 Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, KO, WB
alpha-Sarcoglycan
Antibody (JA51-81)
NBP2-67150
Immunohistochemistry-Paraffin alpha-Sarcoglycan Antibody (JA51-81)
Immunohistochemistry-Paraffin alpha-Sarcoglycan Antibody (JA51-81)
Immunohistochemistry-Frozen alpha-Sarcoglycan Antibody (JA51-81)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IHC-P, IP, WB
PPAN Antibody
NBP1-88525
PPAN Antibody
Species: Hu
Applications: WB, IHC

Publications for PPAN Antibody (NBP1-88525) (0)

There are no publications for PPAN Antibody (NBP1-88525).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for PPAN Antibody (NBP1-88525) (0)

There are no reviews for PPAN Antibody (NBP1-88525). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for PPAN Antibody (NBP1-88525) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional PPAN Products

Research Areas for PPAN Antibody (NBP1-88525)

Find related products by research area.

Blogs on PPAN

There are no specific blogs for PPAN, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our PPAN Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol PPAN