![Western Blot: Podocalyxin Like Antibody [NBP1-83348] - Analysis in control (vector only transfected HEK293T lysate) and PODXL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Podocalyxin-Like-Antibody-Western-Blot-NBP1-83348-img0013.jpg "Western Blot: Podocalyxin Like Antibody [NBP1-83348] - Analysis in control (vector only transfected HEK293T lysate) and PODXL over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPETMSSSPTAASTTHRYPKTPSPTVAHESNWAKCEDLETQTQSEKQLVLNLTGNTLCAGGASDEKLISLICRAVKATFNPAQDKCGIRLASVPGSQTVVVKEITIHTKLPAKDVYERLKDKWDELKEAGVSDMKLGD |
| Marker | Podocytes /Apical Marker, Endothelial Cell Marker |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PODXL |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Podocalyxin Like Antibody (NBP1-83348)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PODXL |
![Immunocytochemistry/Immunofluorescence: Podocalyxin Like Antibody [NBP1-83348] - Staining of human cell line U-251 MG shows localization to nucleoli, plasma membrane, microtubule organizing center & vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Podocalyxin-Like-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83348-img0012.jpg "Immunocytochemistry/Immunofluorescence: Podocalyxin Like Antibody [NBP1-83348] - Staining of human cell line U-251 MG shows localization to nucleoli, plasma membrane, microtubule organizing center & vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Podocalyxin Like Antibody [NBP1-83348] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/Podocalyxin-Like-Antibody-Immunohistochemistry-Paraffin-NBP1-83348-img0017.jpg "Immunohistochemistry-Paraffin: Podocalyxin Like Antibody [NBP1-83348] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Western Blot: Podocalyxin Like Antibody [NBP1-83348] - Analysis in human kidney tissue.](http://images.novusbio.com/fullsize/Podocalyxin-Like-Antibody-Western-Blot-NBP1-83348-img0007.jpg "Western Blot: Podocalyxin Like Antibody [NBP1-83348] - Analysis in human kidney tissue.")
![Immunohistochemistry-Paraffin: Podocalyxin Like Antibody [NBP1-83348] - Staining of human kidney shows high expression.](http://images.novusbio.com/fullsize/Podocalyxin-Like-Antibody-Immunohistochemistry-Paraffin-NBP1-83348-img0008.jpg "Immunohistochemistry-Paraffin: Podocalyxin Like Antibody [NBP1-83348] - Staining of human kidney shows high expression.")
![Immunohistochemistry-Paraffin: Podocalyxin Like Antibody [NBP1-83348] - Analysis in human kidney and liver tissues. Corresponding Podocalyxin Like RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Podocalyxin-Like-Antibody-Immunohistochemistry-Paraffin-NBP1-83348-img0014.jpg "Immunohistochemistry-Paraffin: Podocalyxin Like Antibody [NBP1-83348] - Analysis in human kidney and liver tissues. Corresponding Podocalyxin Like RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Podocalyxin Like Antibody [NBP1-83348] - Staining of human fallopian tube shows strong positivity in cilia in glandular cells.](http://images.novusbio.com/fullsize/Podocalyxin-Like-Antibody-Immunohistochemistry-Paraffin-NBP1-83348-img0015.jpg "Immunohistochemistry-Paraffin: Podocalyxin Like Antibody [NBP1-83348] - Staining of human fallopian tube shows strong positivity in cilia in glandular cells.")
![Immunohistochemistry-Paraffin: Podocalyxin Like Antibody [NBP1-83348] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.](http://images.novusbio.com/fullsize/Podocalyxin-Like-Antibody-Immunohistochemistry-Paraffin-NBP1-83348-img0016.jpg "Immunohistochemistry-Paraffin: Podocalyxin Like Antibody [NBP1-83348] - Staining of human kidney shows strong membranous positivity in cells in glomeruli.")
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunohistochemistry Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nephrin_AF3159_Immunohistochemistry_6775.jpg)
![Immunohistochemistry Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images2/Nephrin_AF3159_Immunohistochemistry_10004.jpg)
![Immunocytochemistry/ Immunofluorescence Nephrin Antibody [Unconjugated]](https://images.novusbio.com/images/af3159_mouse-nephrin-affinity-purified-polyclonal-ab-41202410484365.jpg)
![Immunohistochemistry CD34 Antibody [Unconjugated]](https://images.novusbio.com/images2/CD34_AF4117_Immunohistochemistry_6824.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")