![Western Blot: PIN4 Antibody [H00005303-D01P] - Analysis of PIN4 expression in transfected 293T cell line by PIN4 polyclonal antibody.Lane 1: PIN4 transfected lysate(16.60 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/PIN4-Antibody-Western-Blot-H00005303-D01P-img0004.jpg "Western Blot: PIN4 Antibody [H00005303-D01P] - Analysis of PIN4 expression in transfected 293T cell line by PIN4 polyclonal antibody.Lane 1: PIN4 transfected lysate(16.60 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | PIN4 (NP_006214.2, 1 a.a. - 156 a.a.) full-length human protein. MPMAGLLKGLVRQLERFSVQQQASKMPPKGKSGSGKAGKGGAASGSDSADKKAQGPKGGGNAVKVRHILCEKHGKIMEAMEKLKSGMRFNEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTDPPVKTKFGYHIIMVEGRK |
| Specificity | PIN4 - protein (peptidylprolyl cis/trans isomerase) NIMA-interacting, 4 (parvulin), |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PIN4 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PIN4 |
| Entrez |
|
| Uniprot |
|
![Immunocytochemistry/Immunofluorescence: PIN4 Antibody [H00005303-D01P] - Analysis of antibody to PIN4 on HeLa cell. Antibody concentration 10 ug/ml.](http://images.novusbio.com/fullsize/PIN4-Antibody-Immunocytochemistry-Immunofluorescence-H00005303-D01P-img0003.jpg "Immunocytochemistry/Immunofluorescence: PIN4 Antibody [H00005303-D01P] - Analysis of antibody to PIN4 on HeLa cell. Antibody concentration 10 ug/ml.")
![Western Blot Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Western_Blot_6024.jpg)
![Immunocytochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunocytochemistry__Immunofluorescence_23049.jpg)
![Immunohistochemistry Pin1 Antibody (257417) [Unconjugated]](https://images.novusbio.com/images2/Pin1_MAB2294_Immunohistochemistry_7360.jpg)
![Western Blot FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Western_Blot_5399.jpg)
![Simple Western FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Simple_Western_16755.jpg)
![Immunohistochemistry FKBP51/FKBP5 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP51_AF4094_Immunohistochemistry_6823.jpg)
![Western Blot FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Western_Blot_5411.jpg)
![Simple Western FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Simple_Western_16756.jpg)
![Immunohistochemistry FKBP12.6 Antibody [Unconjugated]](https://images.novusbio.com/images2/FKBP12.6_AF4174_Immunohistochemistry_22269.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")