Home » Phenylalanine Hydroxylase » Phenylalanine Hydroxylase Proteins » Phenylalanine Hydroxylase Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Phenylalanine Hydroxylase Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Phenylalanine Hydroxylase Protein (NBP1-80917PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Phenylalanine Hydroxylase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PAH.

Source: E. coli

Amino Acid Sequence: MSTAVLENPGLGRKLSDFGQETSYIEDNCNQNGAISLIFSLKEEVGALAKVLRLFEENDVNLTHIESRPSRLKKDEYEFFTHLDKRSLPALTNIIKILRHDIGATVHELSRDKKKDTVPWFPRTIQELDRFANQILSYGAELDADHPG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PAH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-80917.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Phenylalanine Hydroxylase Recombinant Protein Antigen

  • EC 1.14.16
  • EC 1.14.16.1
  • PH
  • phe-4-monooxygenase
  • phenylalanine 4-monooxygenase
  • phenylalanine hydroxylase
  • phenylalanine-4-hydroxylase
  • PKU
  • PKU1

Background

PAH encodes the enzyme phenylalanine hydroxylase that is the rate-limiting step in phenylalanine catabolism. Deficiency of this enzyme activity results in the autosomal recessive disorder phenylketonuria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

Pleckstrin Antibody
NB100-1343
Immunohistochemistry-Paraffin Pleckstrin Antibody
Immunohistochemistry-Paraffin Pleckstrin Antibody
Western Blot Pleckstrin Antibody
(2 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Cytochrome P450
1A1/1A2 Antibody (MC1
NB100-74398
Immunocytochemistry/ Immunofluorescence Cytochrome P450 1A1/1A2 Antibody (MC1)
Immunocytochemistry/ Immunofluorescence Cytochrome P450 1A1/1A2 Antibody (MC1)
Immunocytochemistry/ Immunofluorescence Cytochrome P450 1A1/1A2 Antibody (MC1)
(1 Review)
(2 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AHR Antibody
NB100-128
Immunocytochemistry/ Immunofluorescence AHR Antibody
Gel Super Shift Assays AHR Antibody
Immunohistochemistry-Paraffin AHR Antibody
(1 Review)
(17 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, GS, ICC/IF, IHC, IHC-P, WB
RAPGEF5 Antibody
NBP2-57362
Western Blot RAPGEF5 Antibody
Immunocytochemistry/ Immunofluorescence RAPGEF5 Antibody
Species: Hu
Applications: ICC/IF, WB
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(663 Publications)
Species: Mu
Applications: ELISA
Tyrosine
Hydroxylase Antibody
NB300-109
Immunohistochemistry-Frozen Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
Immunohistochemistry Tyrosine Hydroxylase Antibody
(7 Reviews)
(230 Publications)
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
PRB1 Antibody
NBP3-41252
PRB1 Antibody
Species: Hu
Applications: ICC/IF, IHC, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(815 Publications)
Species: Hu
Applications: BA
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
OAT1 Antibody
NBP2-62690
Immunohistochemistry-Paraffin OAT1 Antibody
Immunohistochemistry-Paraffin OAT1 Antibody
Immunohistochemistry-Paraffin OAT1 Antibody
Species: Hu
Applications: IHC, IHC-P
Histatin 3
Antibody (4G9)
H00003347-M01
Sandwich ELISA Histatin 3 Antibody (4G9)
Immunocytochemistry/ Immunofluorescence Histatin 3 Antibody (4G9)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
HAI-2/SPINT2
Antibody [Unconjugate
AF1107
HAI-2/SPINT2 Antibody [Unconjugated]
(3 Publications)
Species: Mu
Applications: IHC, WB
Recombinant Human
PRH2 GST (N-Term) Pro ...
H00005555-P01
SDS-PAGE Recombinant Human PRH2 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
QDPR Antibody
AF8038
Western Blot QDPR Antibody
Species: Hu, Mu, Rt
Applications: WB
CYP1B1 Antibody
NBP2-24722
Immunohistochemistry-Paraffin CYP1B1 Antibody
Western Blot CYP1B1 Antibody
Immunohistochemistry-Paraffin CYP1B1 Antibody
(1 Review)
(5 Publications)
Species: Hu
Applications: IHC, IHC-P, In vitro, WB
Corneodesmosin
Antibody [Unconjugate
AF5725
Immunohistochemistry Corneodesmosin Antibody [Unconjugated]
(3 Publications)
Species: Hu
Applications: IHC
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Phenylalanine
Hydroxylase Recombina ...
NBP1-80917PEP
Phenylalanine Hydroxylase Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for Phenylalanine Hydroxylase Protein (NBP1-80917PEP) (0)

There are no publications for Phenylalanine Hydroxylase Protein (NBP1-80917PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Phenylalanine Hydroxylase Protein (NBP1-80917PEP) (0)

There are no reviews for Phenylalanine Hydroxylase Protein (NBP1-80917PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Phenylalanine Hydroxylase Protein (NBP1-80917PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Phenylalanine Hydroxylase Products

Blogs on Phenylalanine Hydroxylase

There are no specific blogs for Phenylalanine Hydroxylase, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Phenylalanine Hydroxylase Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PAH