![Western Blot: PGD Antibody [NBP1-85925] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)](http://images.novusbio.com/fullsize/PGD-Antibody-Western-Blot-NBP1-85925-img0011.jpg "Western Blot: PGD Antibody [NBP1-85925] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells) Lane 2: NBT-II cell lysate (Rat Wistar bladder tumour cells)")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: FNRTVSKVDDFLANEAKGTKVVGAQSLKEMVSKLKKPRRIILLVKAGQAVDDFIEKLVPLLDTGDIIIDGGNSEYRDTTRRCRDLKAKGILFVGS |
| Predicted Species | Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PGD |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PGD Antibody (NBP1-85925)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PGD |
![Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human lymph node.](http://images.novusbio.com/fullsize/PGD-Antibody-Immunohistochemistry-Paraffin-NBP1-85925-img0014.jpg "Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human lymph node.")
![Western Blot: PGD Antibody [NBP1-85925] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/PGD-Antibody-Western-Blot-NBP1-85925-img0005.jpg "Western Blot: PGD Antibody [NBP1-85925] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human esophagus shows high expression.](http://images.novusbio.com/fullsize/PGD-Antibody-Immunohistochemistry-Paraffin-NBP1-85925-img0008.jpg "Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human esophagus shows high expression.")
![Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human skeletal muscle shows low expression as expected.](http://images.novusbio.com/fullsize/PGD-Antibody-Immunohistochemistry-Paraffin-NBP1-85925-img0009.jpg "Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human skeletal muscle shows low expression as expected.")
![Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining in human esophagus and skeletal muscle tissues using anti-PGD antibody. Corresponding PGD RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/PGD-Antibody-Immunohistochemistry-Paraffin-NBP1-85925-img0010.jpg "Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining in human esophagus and skeletal muscle tissues using anti-PGD antibody. Corresponding PGD RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human esophagus, liver, lymph node and testis using Anti-PGD antibody NBP1-85925 (A) shows similar protein distribution across tissues to independent antibody NBP2-58686 (B).](http://images.novusbio.com/fullsize/PGD-Antibody-Western-Blot-NBP1-85925-img0012.jpg "Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human esophagus, liver, lymph node and testis using Anti-PGD antibody NBP1-85925 (A) shows similar protein distribution across tissues to independent antibody NBP2-58686 (B).")
![Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human testis.](http://images.novusbio.com/fullsize/PGD-Antibody-Immunohistochemistry-Paraffin-NBP1-85925-img0013.jpg "Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human testis.")
![Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human liver.](http://images.novusbio.com/fullsize/PGD-Antibody-Immunohistochemistry-Paraffin-NBP1-85925-img0015.jpg "Immunohistochemistry-Paraffin: PGD Antibody [NBP1-85925] - Staining of human liver.")
![Western Blot Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (735301) [Unconjugated]](https://images.novusbio.com/images2/HPGDS_MAB6487_Western_Blot_11636.jpg)
![Immunocytochemistry Hematopoietic Prostaglandin D Synthase/HPGDS Antibody (735301) [Unconjugated]](https://images.novusbio.com/images2/HPGDS_MAB6487_Immunocytochemistry__Immunofluorescence_19604.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/PlGF_DPG00_ELISA_158.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_788.jpg)
![N/A PLGF [HRP]](https://images.novusbio.com/images2/DATA_PlGF_DPG00_ELISA_789.jpg)
![Holo-Transferrin [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Holo-Transferrin [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")