![Western Blot: PARP Antibody (CL2220) [NBP2-36747] - analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PARP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/PARP-Antibody-CL2220-Western-Blot-NBP2-36747-img0014.jpg "Western Blot: PARP Antibody (CL2220) [NBP2-36747] - analysis in RT-4 cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PARP1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clone | CL2220 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids:KGGKVFSATLGLVDIVKGTNSYYKLQLLEDDKENRYWIFRSWGRVGTVIGSNKLEQMPSKEDAIEHFMKLYEEKTGNAWHSKNFTKYPKKFYPLEIDYGQDEEAVKKLTVNPGTKSKLPKPVQDLIKMIFDVESMKKAM |
| Epitope | SKLPKPVQDL |
| Predicted Species | Mouse (95%), Rat (94%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | PARP1 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for PARP Antibody (NBP2-36747)Find related products by research area.
|
|
NPC1: A Potential Target For Triple-Negative Breast Cancer By Natalia Gurule, PhD Breast Cancer is a Heterogeneous DiseaseBreast cancer is the most frequently identified malignancy in women, accounting for 30% of diagnosed cases of cancer in women in the US annuall... Read full blog post. |
|
Using CometChip to Characterize Extracellular Regulators of DNA Repair: Does CD73 Levels in Cancer Cells Affect DNA Repair by Regulating Levels of Intracellular NAD+? By Natalia Gurule, PhD Historically, DNA repair pathways have been viewed from a tumor cell centric vantage point. Currently, the tumor microenvironment (TME) is recognized as having the potential to be a s... Read full blog post. |
|
What are the major differences between Apoptosis, Necroptosis & Autophagy? Apoptosis is a form of programmed cell death which is mediated by cysteine proteases called caspases. It is an essential phenomenon in the maintenance of homeostasis and growth of tissues, and it also plays a critical role in immune response. The ... Read full blog post. |
|
The role of PARP-1 in the repair of single stranded break (SSB) PARPs (poly ADP ribose polymerases) are DNA repair enzymes that promote single stranded break (SSB) repair by binding to DNA at the sites of SSBs and recruiting repair machinery. In humans, the PARP superfamily consists of 17 members, of which five... Read full blog post. |
|
Caspase 3 - a Reliable Marker for Index of Apoptosis Induction Caspase-3 is one of the most important players in apoptosis signaling. It is synthesized as an inactive 32 kDa pro-enzyme and upon direct activation by Caspase-8, -9 or -10, it gets processed into its active forms, the p17-20 and p10-12 subunits. T... Read full blog post. |
|
Caspase 7 - A key effector of the apoptotic pathway Caspase-7 is an effector caspase with important roles in mediating cell death signaling. As an effector caspase, caspase-7 is cleaved and activated by initiator caspases such as caspase-1 (1). Like other caspase family proteins, caspase-7 contains a... Read full blog post. |
|
Caspase 7: The Cell's Suicide Switch Caspase 7 (also known as CASP7, Mch3, ICE-LAP3, CMH-1) is a member of caspase family of cysteine proteases. It is an apoptosis-related cystein peptidase encoded by the CASP7 gene in humans. CASP7 homologous sequences have been identified in nearly all... Read full blog post. |
|
PARP Antibody Assays aid both Apoptosis and Cancer Research The PARP (Poly(ADP-ribose) polymerase) protein is a zinc-dependant nuclear enzyme whose main role is to detect and repair DNA single-strand breaks (SSB). However, PARP antibody research has revealed there are at least 17 PARP proteins, which also play... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: PARP Antibody (CL2220) [NBP2-36747] - Staining in U251 cell line showing cell cycle dependent nuclear staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PARP-Antibody-CL2220-Immunocytochemistry-Immunofluorescence-NBP2-36747-img0012.jpg "Immunocytochemistry/Immunofluorescence: PARP Antibody (CL2220) [NBP2-36747] - Staining in U251 cell line showing cell cycle dependent nuclear staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PARP Antibody (CL2220) [NBP2-36747] - Staining of human small intestine shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PARP-Antibody-CL2220-Immunohistochemistry-Paraffin-NBP2-36747-img0018.jpg "Immunohistochemistry-Paraffin: PARP Antibody (CL2220) [NBP2-36747] - Staining of human small intestine shows strong nuclear positivity in glandular cells.")
![Immunocytochemistry/Immunofluorescence: PARP Antibody (CL2220) [NBP2-36747] - Staining in HeLa cell line showing cell cycle dependent nuclear staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PARP-Antibody-CL2220-Immunocytochemistry-Immunofluorescence-NBP2-36747-img0008.jpg "Immunocytochemistry/Immunofluorescence: PARP Antibody (CL2220) [NBP2-36747] - Staining in HeLa cell line showing cell cycle dependent nuclear staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: PARP Antibody (CL2220) [NBP2-36747] - Staining of human cell line A431 showing cell cycle dependent nuclear staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PARP-Antibody-CL2220-Immunocytochemistry-Immunofluorescence-NBP2-36747-img0009.jpg "Immunocytochemistry/Immunofluorescence: PARP Antibody (CL2220) [NBP2-36747] - Staining of human cell line A431 showing cell cycle dependent nuclear staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: PARP Antibody (CL2220) [NBP2-36747] - Staining in MCF7 cell line showing clear cycle dependent nuclear staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PARP-Antibody-CL2220-Immunocytochemistry-Immunofluorescence-NBP2-36747-img0010.jpg "Immunocytochemistry/Immunofluorescence: PARP Antibody (CL2220) [NBP2-36747] - Staining in MCF7 cell line showing clear cycle dependent nuclear staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: PARP Antibody (CL2220) [NBP2-36747] - Staining in U2OS cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PARP-Antibody-CL2220-Immunocytochemistry-Immunofluorescence-NBP2-36747-img0011.jpg "Immunocytochemistry/Immunofluorescence: PARP Antibody (CL2220) [NBP2-36747] - Staining in U2OS cell line with Anti-PARP1 monoclonal antibody, showing cell cycle dependent nuclear staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: PARP Antibody (CL2220) [NBP2-36747] - Staining of human tonsil shows strong nuclear positivity in lymphoid cells.](http://images.novusbio.com/fullsize/PARP-Antibody-CL2220-Immunohistochemistry-Paraffin-NBP2-36747-img0015.jpg "Immunohistochemistry-Paraffin: PARP Antibody (CL2220) [NBP2-36747] - Staining of human tonsil shows strong nuclear positivity in lymphoid cells.")
![Immunohistochemistry-Paraffin: PARP Antibody (CL2220) [NBP2-36747] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/PARP-Antibody-CL2220-Immunohistochemistry-Paraffin-NBP2-36747-img0016.jpg "Immunohistochemistry-Paraffin: PARP Antibody (CL2220) [NBP2-36747] - Staining of human testis shows strong nuclear positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: PARP Antibody (CL2220) [NBP2-36747] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/PARP-Antibody-CL2220-Immunohistochemistry-Paraffin-NBP2-36747-img0017.jpg "Immunohistochemistry-Paraffin: PARP Antibody (CL2220) [NBP2-36747] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.")
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![Western Blot Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Western_Blot_5909.jpg)
![Immunocytochemistry Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Immunocytochemistry__Immunofluorescence_22092.jpg)
![Knockout Validated Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Knockout_Validated_22544.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_5991.jpg)
![Western Blot JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Western_Blot_6327.jpg)
![Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]](https://images.novusbio.com/images2/JNK1_MAB17761_Immunocytochemistry__Immunofluorescence_20184.jpg)
![Simple Western BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Simple_Western_16992.jpg)
![Western Blot BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Western_Blot_22585.jpg)
![Western Blot BID Antibody [Unconjugated]](https://images.novusbio.com/images2/BID_AF860_Western_Blot_9663.jpg)
![Western Blot AIF Antibody [Unconjugated]](https://images.novusbio.com/images2/AIF_AF1457_Western_Blot_5113.jpg)
![Simple Western AIF Antibody [Unconjugated]](https://images.novusbio.com/images2/16334.jpg)
![Knockout Validated AIF Antibody [Unconjugated]](https://images.novusbio.com/images2/AIF_AF1457_Knockout_Validated_22786.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")