![Immunocytochemistry/Immunofluorescence: PARD6B Antibody [NBP1-87337] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/PARD6B-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87337-img0004.jpg "Immunocytochemistry/Immunofluorescence: PARD6B Antibody [NBP1-87337] - Staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green. Antibody staining is shown in green.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: NYHKAVSTANPLLRIFIQKKEEADYSAFGTDTLIKKKNVLTNVLRPDNHRKKPHIVISMPQDFRPVSSIIDVDILPETHRRV |
| Predicted Species | Rat (96%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PARD6B |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Use in ChIP reported in scientific literature (PMID:33242849). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for PARD6B Antibody (NBP1-87337)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PARD6B |
![Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.](http://images.novusbio.com/fullsize/PARD6B-Antibody-Immunohistochemistry-Paraffin-NBP1-87337-img0007.jpg "Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human placenta shows weak cytoplasmic positivity in trophoblastic cells.")
![Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human pancreas shows very weak positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/PARD6B-Antibody-Immunohistochemistry-Paraffin-NBP1-87337-img0005.jpg "Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human pancreas shows very weak positivity in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.](http://images.novusbio.com/fullsize/PARD6B-Antibody-Immunohistochemistry-Paraffin-NBP1-87337-img0006.jpg "Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human lung shows moderate cytoplasmic positivity in macrophages.")
![Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/PARD6B-Antibody-Immunohistochemistry-Paraffin-NBP1-87337-img0008.jpg "Immunohistochemistry-Paraffin: PARD6B Antibody [NBP1-87337] - Staining of human kidney shows weak to moderate cytoplasmic positivity in cells in tubules.")
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![Western Blot MARK2 [p Thr595] Antibody](https://images.novusbio.com/images/nbp1-78028_rabbit-polyclonal-mark2-p-thr595-antibody-255202313135151.jpg)
![Western Blot MARK2 [p Thr595] Antibody](https://images.novusbio.com/images/MARK2-[p-Thr595]-Antibody-Western-Blot-NBP1-78028-img0001.jpg)
![Western Blot MARK2 [p Thr595] Antibody](https://images.novusbio.com/images/MARK2-[p-Thr595]-Antibody-Western-Blot-NBP1-78028-img0002.jpg)
![Immunohistochemistry Cathepsin H Antibody [Unconjugated]](https://images.novusbio.com/images2/Cathepsin_H_AF1013_Immunohistochemistry_6663.jpg)
![Flow Cytometry MMP-14/MT1-MMP Antibody (128527) [Unconjugated]](https://images.novusbio.com/images2/MMP-14_MAB9181_Flow_Cytometry_11258.jpg)
![Immunohistochemistry MMP-14/MT1-MMP Antibody (128527) [Unconjugated]](https://images.novusbio.com/images2/mab9181_human-mmp-14-mt1-mmp-mab-clone-128527-immunohistochemistry-239202215152.jpg)
![Immunohistochemistry JAM-C Antibody [Unconjugated]](https://images.novusbio.com/images2/JAM-C_AF1213_Immunohistochemistry_10165.jpg)
![Immunocytochemistry JAM-C Antibody [Unconjugated]](https://images.novusbio.com/images2/JAMC_AF1213_Immunocytochemistry__Immunofluorescence_17388.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")