![Western Blot: Pannexin-1 Antibody [NBP1-92241] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PANX1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/Pannexin-1-Antibody-Western-Blot-NBP1-92241-img0008.jpg "Western Blot: Pannexin-1 Antibody [NBP1-92241] - Analysis in U-138MG cells transfected with control siRNA, target specific siRNA probe #1 and #2, using Anti-PANX1 antibody. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: VLKVYEILPTFDVLHFKSEGYNDLSLYNLFLEENISEVKSYKCLKVLENIKSSGQGIDPMLLLTNLGMIKMDVVDGKTPMSAEMREEQGNQTAELQGMNIDSETKANNGEKNARQRLLDSSC |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | PANX1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Pannexin-1 Antibody (NBP1-92241)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | PANX1 |
![Immunocytochemistry/Immunofluorescence: Pannexin-1 Antibody [NBP1-92241] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Pannexin-1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-92241-img0010.jpg "Immunocytochemistry/Immunofluorescence: Pannexin-1 Antibody [NBP1-92241] - Staining of human cell line A-431 shows localization to plasma membrane. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-92241] - Staining of human small intestine shows moderate membranous positivity in glandular cells.](http://images.novusbio.com/fullsize/Pannexin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-92241-img0016.jpg "Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-92241] - Staining of human small intestine shows moderate membranous positivity in glandular cells.")
![Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-92241] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/Pannexin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-92241-img0012.jpg "Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-92241] - Staining of human prostate shows moderate cytoplasmic positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-92241] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/Pannexin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-92241-img0014.jpg "Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-92241] - Staining of human testis shows strong membranous positivity in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-92241] - Staining of human pancreas shows negative to very weak positivity in exocrine glandular cells.](http://images.novusbio.com/fullsize/Pannexin-1-Antibody-Immunohistochemistry-Paraffin-NBP1-92241-img0015.jpg "Immunohistochemistry-Paraffin: Pannexin-1 Antibody [NBP1-92241] - Staining of human pancreas shows negative to very weak positivity in exocrine glandular cells.")
![IL-18/IL-1F4 [HRP]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "IL-18/IL-1F4 [HRP]")
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_6973.jpg)
![Immunohistochemistry CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images2/CFTR_MAB25031_Immunohistochemistry_9671.jpg)
![Immunoprecipitation CFTR Antibody (24-1) [Unconjugated] - C-terminus](https://images.novusbio.com/images/mab25031_human-cftr-c-terminus-mab-clone-24-1-41202412513815.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")