![Immunohistochemistry-Paraffin: p53 Antibody (CL2199) [NBP2-34495] - Staining in human skin and skeletal muscle tissues. Corresponding p53 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Immunohistochemistry-Paraffin-NBP2-34495-img0021.jpg "Immunohistochemistry-Paraffin: p53 Antibody (CL2199) [NBP2-34495] - Staining in human skin and skeletal muscle tissues. Corresponding p53 RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | WB, Simple Western, ICC/IF, IHC, KD |
| Clone | CL2199 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: KKGEPHHELPPGSTKRALPNNTSSSPQPKKKPLDGEYFTLQIRGRERFEMFRELNEALELKDAQAGKEPGGSRAHSSHLKSKKGQSTSR |
| Epitope | EYFTLQIRGRERFEM |
| Predicted Species | Rat (91%). Backed by our 100% Guarantee. |
| Isotype | IgG1 |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | TP53 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size. |
|
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Protein A purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
![Immunohistochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunohistochemistry_20892.jpg)
![Immunocytochemistry EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Immunocytochemistry__Immunofluorescence_21143.jpg)
![Western Blot EGFR Antibody [Unconjugated]](https://images.novusbio.com/images2/EGF_R_AF231_Western_Blot_19925.jpg)
| Publication using NBP2-34495 | Applications | Species |
|---|---|---|
| Kar S, Katti D, Katti K Bone Interface Modulates Drug Resistance in Breast Cancer Bone Metastasis Colloids and Surfaces B: Biointerfaces 2020-01-01 [PMID: 32634713] (ICC/IF, PCR, Human) | ICC/IF, PCR | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for p53 Antibody (NBP2-34495)Find related products by research area.
|
|
Developmental regulator Daam2 promotes glial cell tumors by degrading Von Hippel-Lindau protein By Jamshed Arslan Pharm.D. Glioblastoma is an aggressive type of cancer that forms from the star-shaped glial cells of the central nervous system, called astrocytes. Intriguingly, several genes linked to glioblasto... Read full blog post. |
|
Autophagy independent roles of the core ATG proteins By Christina Towers, PhD. Autophagy and ATG ProteinsAutophagy is a nutrient recycling process that cells use to fuel metabolism, particularly in response to nutrient deprivation. It is critical for removal of dam... Read full blog post. |
|
Killing two birds with one stone: Treating inflammation and cancer by inhibiting prolyl-4-hydroxylase-1 By Jamshed Arslan Pharm.D. The cell’s oxygen-sensing machinery comprises prolyl-4-hydroxylases (P4Hs 1-3, PHDs 1-3, or EGLN 1-3) and their canonical target hypoxia-inducible factors (HIFs). When oxygen levels ... Read full blog post. |
|
Pathway Highlight: Which caspase substrates contribute to the morphological features associated with apoptosis? Apoptosis, or programmed cell death, is controlled by a caspase signal cascade that activates downstream signals to induce the morphological changes used to differentiate apoptosis from other forms of cell death. Novus Biologicals offers a variet... Read full blog post. |
|
The role of p53 in UV radiation DNA damage and subsequent tumorogenesis p53, the protein product of the tp53 gene, is one of the most widely studied tumor suppressor proteins in cancer research. p53 is unique in that it demonstrates both tumor suppressive and tumor progressive properties depending on whether it is fu... Read full blog post. |
|
MAPK8/JNK1 - A multifunctional kinase and drug target for cancer therapeutics The c-Jun N-terminal kinase (JNK) family is a group of regulatory kinases with important functions in cell morphogenesis, inflammation, differentiation, and cell death (1). Aberrant activation of JNK family proteins in cancers has led to interest i... Read full blog post. |
|
p53 - Investigating an important tumor suppressor p53 is a tumor suppressor that has a central role in regulating cell cycle arrest, DNA repair, and apoptosis. p53 is widely studied for its role in cancer and is mutated or altered in more than half of all cancers (1). This widespread role in tumor... Read full blog post. |
|
ATM - detecting and responding to DNA damage Ataxia telangiectasia mutated (ATM) is essential for the maintenance of genomic stability. ATM is a 370 kDa serine-threonine kinase that is constitutively expressed in various tissues. Although primarily nuclear, ATM is also found at lower levels ... Read full blog post. |
|
NOXA - a BH3-only protein balancing cell death decisions Noxa is a BH3-only protein involved in regulating cell death decisions. Noxa is a primary p53-response gene and is upregulated in response to p53 overexpression or DNA damage. Noxa can also be induced by alternative mechanisms including through a ... Read full blog post. |
|
p73: An Important Tumor Suppressor Cousin of p53 p73 has been identified as a long-lost cousin of the p53 tumor suppressor protein. It has high homology with both p53 and with p63, a gene implicated in the maintenance of epithelial stem cells. The presence of significant homology between the DNA-bin... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Western Blot: p53 Antibody (CL2199) [NBP2-34495] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-P53 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-PPIB monoclonal antibody was used as loading control.](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Western-Blot-NBP2-34495-img0015.jpg "Western Blot: p53 Antibody (CL2199) [NBP2-34495] - Analysis of extracts from U-251 cells, transfected with: control siRNA, target specific siRNA probe #1, target specific siRNA probe #2, using Anti-P53 monoclonal antibody. Downregulation of antibody signal confirms target specificity. Remaining % intensity, relative control lane, is indicated. Anti-PPIB monoclonal antibody was used as loading control.")
![Immunocytochemistry/Immunofluorescence: p53 Antibody (CL2199) [NBP2-34495] - Staining in U2OS cell line with Anti-p53 monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Immunocytochemistry-Immunofluorescence-NBP2-34495-img0014.jpg "Immunocytochemistry/Immunofluorescence: p53 Antibody (CL2199) [NBP2-34495] - Staining in U2OS cell line with Anti-p53 monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Western Blot: p53 Antibody (CL2199) [NBP2-34495] - Lane 1: Marker [kDa] Lane 2: Human cell line U-251](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Western-Blot-NBP2-34495-img0008.jpg "Western Blot: p53 Antibody (CL2199) [NBP2-34495] - Lane 1: Marker [kDa] Lane 2: Human cell line U-251")
![Immunocytochemistry/Immunofluorescence: p53 Antibody (CL2199) [NBP2-34495] - Staining of human cell line A431 showing cell cycle dependent nuclear (without nucleoli)Staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Immunocytochemistry-Immunofluorescence-NBP2-34495-img0010.jpg "Immunocytochemistry/Immunofluorescence: p53 Antibody (CL2199) [NBP2-34495] - Staining of human cell line A431 showing cell cycle dependent nuclear (without nucleoli)Staining in green. Microtubule-staining and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green")
![Immunocytochemistry/Immunofluorescence: p53 Antibody (CL2199) [NBP2-34495] - Staining in MCF7 cell line with Anti-p53 monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Immunocytochemistry-Immunofluorescence-NBP2-34495-img0012.jpg "Immunocytochemistry/Immunofluorescence: p53 Antibody (CL2199) [NBP2-34495] - Staining in MCF7 cell line with Anti-p53 monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunocytochemistry/Immunofluorescence: p53 Antibody (CL2199) [NBP2-34495] - Staining in U251 cell line with Anti-p53 monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Immunocytochemistry-Immunofluorescence-NBP2-34495-img0013.jpg "Immunocytochemistry/Immunofluorescence: p53 Antibody (CL2199) [NBP2-34495] - Staining in U251 cell line with Anti-p53 monoclonal antibody, showing cell cycle dependent nuclear (without nucleoli) staining in green. Microtubule- and nuclear probes are visualized in red and blue respectively (where available). Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: p53 Antibody (CL2199) [NBP2-34495] - Staining of human colorectal cancer shows strong nuclear positivity in tumor cells, but not in normal mucosa.](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Immunohistochemistry-Paraffin-NBP2-34495-img0017.jpg "Immunohistochemistry-Paraffin: p53 Antibody (CL2199) [NBP2-34495] - Staining of human colorectal cancer shows strong nuclear positivity in tumor cells, but not in normal mucosa.")
![Immunohistochemistry-Paraffin: p53 Antibody (CL2199) [NBP2-34495] - Staining of human lung cancer (squamous cell carcinoma) shows strong nuclear positivity in tumor cells.](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Immunohistochemistry-Paraffin-NBP2-34495-img0018.jpg "Immunohistochemistry-Paraffin: p53 Antibody (CL2199) [NBP2-34495] - Staining of human lung cancer (squamous cell carcinoma) shows strong nuclear positivity in tumor cells.")
![Immunohistochemistry-Paraffin: p53 Antibody (CL2199) [NBP2-34495] - Staining of human skin shows moderate to strong nuclear positivity in a subset of epidermal cells.](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Immunohistochemistry-Paraffin-NBP2-34495-img0019.jpg "Immunohistochemistry-Paraffin: p53 Antibody (CL2199) [NBP2-34495] - Staining of human skin shows moderate to strong nuclear positivity in a subset of epidermal cells.")
![Immunohistochemistry-Paraffin: p53 Antibody (CL2199) [NBP2-34495] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Immunohistochemistry-Paraffin-NBP2-34495-img0020.jpg "Immunohistochemistry-Paraffin: p53 Antibody (CL2199) [NBP2-34495] - Staining of human skeletal muscle shows no positivity in striated muscle fibers as expected.")
![Simple Western: p53 Antibody (CL2199) [NBP2-34495] - Simple Western lane view shows a specific band for P53 in 0.2 mg/ml of Hek293T lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Simple-Western-NBP2-34495-img0009.jpg "Simple Western: p53 Antibody (CL2199) [NBP2-34495] - Simple Western lane view shows a specific band for P53 in 0.2 mg/ml of Hek293T lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.")
![Simple Western: p53 Antibody (CL2199) [NBP2-34495] - Electropherogram image(s) of corresponding Simple Western lane view. p53 antibody was used at 1:50 dilution on Hek293T lysate(s).](http://images.novusbio.com/fullsize/p53-Antibody-CL2199-Simple-Western-NBP2-34495-img0011.jpg "Simple Western: p53 Antibody (CL2199) [NBP2-34495] - Electropherogram image(s) of corresponding Simple Western lane view. p53 antibody was used at 1:50 dilution on Hek293T lysate(s).")
![Western Blot Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Western_Blot_5909.jpg)
![Immunocytochemistry Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Immunocytochemistry__Immunofluorescence_22092.jpg)
![Knockout Validated Bax Antibody [Unconjugated]](https://images.novusbio.com/images2/Bax_AF820_Knockout_Validated_22544.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_6532.jpg)
![Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase3_AF835_Immunohistochemistry_22976.jpg)
![Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active](https://images.novusbio.com/images2/Caspase-3_AF835_Immunocytochemistry_9340.jpg)
![SDS-PAGE ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/ErbB2_1129-ER_70.jpg)
![Bioactivity ErbB2/Her2 [Unconjugated]](https://images.novusbio.com/images2/1129-er_recombinant-human-erbb2-her2-fc-chimera-protein-cf-bioactivity-7122020142841.jpg)
![SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.](https://images.novusbio.com/images/Mouse-IgG1-Isotype-Control-MG1-SDS-Page-NBP1-97005-img0002.jpg "SDS-Page: Mouse IgG1 Isotype Control (MG1) [NBP1-97005] - Lane 1: , Non-reduced. M: Opal Pre-stained Ladder. Lane 2: , Reduced. Load: 1.0 ug per lane. Predicted/Observed: 120 kDa Non-reduced, 55 and 25 Reduced.")