![Western Blot: Opticin Antibody [NBP2-55115] - Analysis in control (vector only transfected HEK293T lysate) and OPTC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).](http://images.novusbio.com/fullsize/Opticin-Antibody-Western-Blot-NBP2-55115-img0003.jpg "Western Blot: Opticin Antibody [NBP2-55115] - Analysis in control (vector only transfected HEK293T lysate) and OPTC over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).")
| Reactivity | HuSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: LPRKERKRREEQMPREGDSFEVLPLRNDVLNPDNYGEVIDLSNYEELTDYGDQLPEVKVTSLAPATSISP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OPTC |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OPTC |
![Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human kidney.](http://images.novusbio.com/fullsize/Opticin-Antibody-Immunohistochemistry-Paraffin-NBP2-55115-img0006.jpg "Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human eye shows moderate positivity in vitreous of the eye.](http://images.novusbio.com/fullsize/Opticin-Antibody-Immunohistochemistry-Paraffin-NBP2-55115-img0002.jpg "Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human eye shows moderate positivity in vitreous of the eye.")
![Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human duodenum, eye, kidney and lymph node using Anti-OPTC antibody NBP2-55115 (A) shows similar protein distribution across tissues to independent antibody NBP1-85914 (B).](http://images.novusbio.com/fullsize/Opticin-Antibody-Immunohistochemistry-Paraffin-NBP2-55115-img0004.jpg "Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human duodenum, eye, kidney and lymph node using Anti-OPTC antibody NBP2-55115 (A) shows similar protein distribution across tissues to independent antibody NBP1-85914 (B).")
![Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human lymph node.](http://images.novusbio.com/fullsize/Opticin-Antibody-Immunohistochemistry-Paraffin-NBP2-55115-img0005.jpg "Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human duodenum.](http://images.novusbio.com/fullsize/Opticin-Antibody-Immunohistochemistry-Paraffin-NBP2-55115-img0007.jpg "Immunohistochemistry-Paraffin: Opticin Antibody [NBP2-55115] - Staining of human duodenum.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![SDS-PAGE LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_719.jpg)
![Bioactivity LIGHT/TNFSF14 [Unconjugated]](https://images.novusbio.com/images2/LIGHT_664-LI_721.jpg)
![Western Blot PRELP Antibody [Unconjugated]](https://images.novusbio.com/images2/PRELP_AF6447_Western_Blot_11110.jpg)
![Immunocytochemistry PRELP Antibody [Unconjugated]](https://images.novusbio.com/images2/PRELP_AF6447_Immunocytochemistry_12159.jpg)
![Western Blot Lumican Antibody [Unconjugated]](https://images.novusbio.com/images2/Lumican_AF2846_Western_Blot_17014.jpg)
![Immunohistochemistry Lumican Antibody [Unconjugated]](https://images.novusbio.com/images2/Lumican_AF2846_Immunohistochemistry_17809.jpg)
![Immunocytochemistry RUNX2/CBFA1 Antibody (232902) [Unconjugated]](https://images.novusbio.com/images2/RUNX2_MAB2006_Immunocytochemistry_13309.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/DATA_MMP2_MMP200_ELISA_1003.jpg)
![N/A MMP-2 [HRP]](https://images.novusbio.com/images2/MMP2_MMP200_ELISA_474.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")