![Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Analysis in human cerebral cortex and liver tissues. Corresponding OMgp RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/OMgp-Antibody-Immunohistochemistry-Paraffin-NBP1-82483-img0015.jpg "Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Analysis in human cerebral cortex and liver tissues. Corresponding OMgp RNA-seq data are presented for the same tissues.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: LPSGLQENIIHLNLSYNHFTDLHNQLTQYTNLRTLDISNNRLESLPAHLPRSLWNMSAANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSNK |
| Predicted Species | Mouse (97%), Rat (97%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | OMG |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-82483 | Applications | Species |
|---|---|---|
| Chang KJ, Susuki K, Dours-Zimmermann MT et al. Oligodendrocyte myelin glycoprotein does not influence node of ranvier structure or assembly. J Neurosci 2010-10-01 [PMID: 20980605] |
Secondary Antibodies |
Isotype Controls |
Research Areas for OMgp Antibody (NBP1-82483)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | OMG |
![Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human caudate nucleus, cerebral cortex, kidney and liver using Anti-OMgp antibody NBP1-82483 (A) shows similar protein distribution across tissues to independent antibody NBP1-82484 (B).](http://images.novusbio.com/fullsize/OMgp-Antibody-Immunohistochemistry-Paraffin-NBP1-82483-img0019.jpg "Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human caudate nucleus, cerebral cortex, kidney and liver using Anti-OMgp antibody NBP1-82483 (A) shows similar protein distribution across tissues to independent antibody NBP1-82484 (B).")
![Western Blot: OMgp Antibody [NBP1-82483] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize/OMgp-Antibody-Western-Blot-NBP1-82483-img0007.jpg "Western Blot: OMgp Antibody [NBP1-82483] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp")
![Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human liver shows no positivity in hepatocytes as expected.](http://images.novusbio.com/fullsize/OMgp-Antibody-Immunohistochemistry-Paraffin-NBP1-82483-img0021.jpg "Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human liver shows no positivity in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human kidney.](http://images.novusbio.com/fullsize/OMgp-Antibody-Immunohistochemistry-Paraffin-NBP1-82483-img0014.jpg "Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human kidney.")
![Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human caudate nucleus shows moderate to strong positivity in neuronal processes.](http://images.novusbio.com/fullsize/OMgp-Antibody-Immunohistochemistry-Paraffin-NBP1-82483-img0016.jpg "Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human caudate nucleus shows moderate to strong positivity in neuronal processes.")
![Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human cerebral cortex shows moderate positivity in neuropil, as well as staining in glial cells.](http://images.novusbio.com/fullsize/OMgp-Antibody-Immunohistochemistry-Paraffin-NBP1-82483-img0018.jpg "Immunohistochemistry-Paraffin: OMgp Antibody [NBP1-82483] - Staining of human cerebral cortex shows moderate positivity in neuropil, as well as staining in glial cells.")
![Immunohistochemistry NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Immunohistochemistry_6685.jpg)
![Western Blot NGFR/TNFRSF16/p75NTR Antibody [Unconjugated]](https://images.novusbio.com/images2/NGF_R_AF1157_Western_Blot_17941.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_587.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/DATA_BDNF_DBD00_ELISA_588.jpg)
![N/A BDNF [HRP]](https://images.novusbio.com/images2/BDNF_DBD00_ELISA_36.jpg)
![Western Blot LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12543.jpg)
![Immunocytochemistry LEDGF Antibody (762815) [Unconjugated]](https://images.novusbio.com/images2/12613.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/TNF_RII_DRT200_ELISA_176.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_817.jpg)
![N/A TNF RII/TNFRSF1B [HRP]](https://images.novusbio.com/images2/DATA_TNF_RII_DRT200_ELISA_818.jpg)
![Neutralization Siglec-7/CD328 Antibody [Unconjugated]](https://images.novusbio.com/images2/Siglec-7_AF1138_Block_Neutralize_8760.jpg)
![Immunohistochemistry LINGO-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/LINGO1_AF3086_Immunohistochemistry_19142.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")