Numb Antibody (9X1Y0) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NUMB (P49757). MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICEDAVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDE |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
NUMB |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunoprecipitation 1:500 - 1:1000
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS, 0.05% BSA, 50% glycerol, pH7.3 |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for Numb Antibody (9X1Y0)
Background
Numb is a transmembrane signaling receptor that is activated by the DSL family of ligands. Studies suggestthat mammalian Numb plays a role in progenitor cell fate in neurogenesis. Numb exerts its role on cell fate by antagonizing Notch signaling. The mammalian Numb gene undergoes alternative splicing to produce at least four functionally different Numb isoforms which regulate different processes. A loss of Numb expression has been demonstrated in breast cancer, non-small cell lung cancer and chronic myelogenous leukemia.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, WB (-)
Species: Hu, Mu, Rt(-)
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
Species: Hu
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, Single-Cell Western, WB
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: DirELISA, IP, WB
Species: Hu
Applications: ICC, IHC, IHC-P, WB (-)
Species: Mu
Applications: Block, WB
Species: Hu, Mu
Applications: WB, IP
Publications for Numb Antibody (NBP3-16738) (0)
There are no publications for Numb Antibody (NBP3-16738).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Numb Antibody (NBP3-16738) (0)
There are no reviews for Numb Antibody (NBP3-16738).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Numb Antibody (NBP3-16738) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Numb Products
Research Areas for Numb Antibody (NBP3-16738)
Find related products by research area.
|
Blogs on Numb