Home » NT5C » NT5C Proteins » NT5C Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NT5C Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NT5C Protein (NBP1-84563PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NT5C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NT5C.

Source: E. coli

Amino Acid Sequence: VLADFEAGLLRGFRRRFPEEPHVPLEQRRGFLAREQYRALRPDLADKVASVYEAPGFFLDLEPIP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NT5C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-84563.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NT5C Recombinant Protein Antigen

  • 3'-pyrimidine nucleotidase
  • 5' nucleotidase, deoxy (pyrimidine), cytosolic type C
  • 5', 3'-nucleotidase, cytosolic
  • cdN
  • Cytosolic 5'
  • Deoxy-5'-nucleotidase 1
  • dNT-15'(3')-deoxyribonucleotidase, cytosolic type
  • DNT1DNT-1
  • EC 3.1.3.-
  • P5N2
  • PN-I
  • PN-II
  • UMPH2DNT
  • uridine 5'-monophosphate phosphohydrolase 2
  • uridine 5-prime monophosphate hydrolase 2

Background

Pyrimidine 5-prime nucleotidase (P5N; EC 3.1.3.5), also called uridine 5-prime monophosphate hydrolase (UMPH), catalyzes the dephosphorylation of the pyrimidine 5-prime monophosphates UMP and CMP to the corresponding nucleosides. There are 2 isozymes of pyrimidine 5-prime nucleotidase in red blood cells, referred to as type I (UMPH1; MIM 606224) and type II (UMPH2).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


5'-Nucleotidase/CD73 A ...
NBP2-48480
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow (Cell Surface) 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
Flow Cytometry 5'-Nucleotidase/CD73 Antibody (AD2) - BSA Free
(1 Review)
(15 Publications)
Species: Hu
Applications: Flow-CS, Flow, IHC, IHC-Fr, IHC-P
beta Amyloid
Antibody (MOAB-2) - B ...
NBP2-13075
Immunohistochemistry-Frozen beta Amyloid Antibody (MOAB-2) - BSA Free
Immunohistochemistry beta Amyloid Antibody (MOAB-2) - BSA Free
Immunocytochemistry/ Immunofluorescence beta Amyloid Antibody (MOAB-2) - BSA Free
(2 Reviews)
(70 Publications)
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western Blot Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
Immunohistochemistry Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
ELISA Prostatic Acid Phosphatase/ACPP Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(842 Publications)
Species: Hu
Applications: BA
NT5M Antibody
NBP1-92203
Western Blot NT5M Antibody
Immunohistochemistry-Paraffin NT5M Antibody
Species: Hu
Applications: IHC, IHC-P, WB
u-Plasminogen
Activator/Urokinase [ ...
1310-SE
Enzyme Activity u-Plasminogen Activator/Urokinase [Unconjugated]
(14 Publications)
Species: Hu
Applications: EnzAct
KGF/FGF-7
[Unconjugated]
251-KG
Bioactivity KGF/FGF-7 [Unconjugated]
Bioactivity KGF/FGF-7 [Unconjugated]
(85 Publications)
Species: Hu
Applications: BA
Thymidine Kinase 1
Antibody
NBP2-20626
Immunohistochemistry-Paraffin Thymidine Kinase 1 Antibody
Western Blot Thymidine Kinase 1 Antibody
Western Blot Thymidine Kinase 1 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, KO, WB
NT5C3 Antibody
NBP1-85525
Western Blot NT5C3 Antibody
Immunohistochemistry-Paraffin NT5C3 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
ENT1 Antibody
NBP1-84838
Immunohistochemistry-Paraffin ENT1 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Citidine Deaminase
Antibody
NBP2-39019
Immunocytochemistry/ Immunofluorescence Citidine Deaminase Antibody
Immunohistochemistry-Paraffin Citidine Deaminase Antibody
Immunohistochemistry-Paraffin Citidine Deaminase Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
DCK Antibody
(10412)
NBP2-43639
Western Blot DCK Antibody (10412)
Immunocytochemistry/ Immunofluorescence DCK Antibody (10412)
Western Blot DCK Antibody (10412)
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
KCNE1 Antibody
(5B12)
H00003753-M01
ELISA KCNE1 Antibody (5B12)
Western Blot KCNE1 Antibody (5B12)
Western Blot KCNE1 Antibody (5B12)
(4 Publications)
Species: Ca, Gp, Hu, Pm, Rt
Applications: ELISA, ICC/IF, KD, WB
Furin Antibody
NB100-1903
Flow Cytometry Furin Antibody
Western Blot Furin Antibody
Immunocytochemistry/ Immunofluorescence Furin Antibody
(1 Review)
(2 Publications)
Species: Ca, Ha, Hu, Mu, Po, Pm, Rt
Applications: B/N, Flow, ICC/IF, IHC, IHC-P, IP, WB
NT5C2 Antibody
(3C1)
H00022978-M02
Immunocytochemistry/ Immunofluorescence NT5C2 Antibody (3C1)
Western Blot NT5C2 Antibody (3C1)
Immunohistochemistry-Paraffin NT5C2 Antibody (3C1)
(8 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
MAP4K6 Antibody
NBP1-22990
Western Blot MAP4K6 Antibody
(5 Publications)
Species: Hu, Mu
Applications: IP, WB
PD-ECGF/Thymidine
Phosphorylase Antibod ...
NB100-2737
Immunohistochemistry PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) - BSA Free
Immunohistochemistry PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) - BSA Free
Immunohistochemistry PD-ECGF/Thymidine Phosphorylase Antibody (PGF 44C) - BSA Free
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IP, WB
Thymidylate
Synthase Antibody (HL ...
NBP3-25721
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Western Blot Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Immunohistochemistry-Paraffin Thymidylate Synthase Antibody (HL1236) - Azide and BSA Free
Species: Ca, Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NT5C Recombinant
Protein Antigen
NBP1-84563PEP
NT5C Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for NT5C Protein (NBP1-84563PEP) (0)

There are no publications for NT5C Protein (NBP1-84563PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NT5C Protein (NBP1-84563PEP) (0)

There are no reviews for NT5C Protein (NBP1-84563PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NT5C Protein (NBP1-84563PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NT5C Products

Blogs on NT5C

There are no specific blogs for NT5C, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NT5C Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NT5C