Home » nSMase » nSMase Proteins » nSMase Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

nSMase Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for nSMase Protein (NBP1-87810PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

nSMase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SMPD2.

Source: E. coli

Amino Acid Sequence: QFIHHTSKKADVVLLCGDLNMHPEDLGCCLLKEWTGLHDAYLETRDFKGSEEGNTMVPKNCYVSQQELKPFPFGVRIDYVLYKAVSGFYISCKSFETTTGFDPHRGTPLSDHEALMATLFVRHSPPQQNPSST

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SMPD2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87810.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for nSMase Recombinant Protein Antigen

  • EC 3.1.4.12
  • ISC1
  • lyso-PAF-PLC
  • Lyso-platelet-activating factor-phospholipase C
  • Neutral sphingomyelinase
  • NSMASE
  • N-SMase
  • NSMASE1
  • sphingomyelin phosphodiesterase 2
  • sphingomyelin phosphodiesterase 2, neutral membrane (neutral sphingomyelinase)

Background

Sphingomyelin is also present in all eukaryotic cell membranes, especially the plasma membrane, and is particularly concentrated in the nervous system because sphingomyelin is a major component of myelin, the fatty insulation wrapped around nerve cells by Schwann cells or oligodendrocytes. Multiple Sclerosis is a disease characterised by deterioration of the myelin sheath, leading to impairment of nervous conduction. nSMase (Neutral sphingomyelinase; Sphingomyelin phosphodiesterase 2) converts sphingomyelin to ceramide. Although widely expressed in all tissues examined, except the spleen, high enzymatic activity occurs only in the brain. Mice lacking Smpd2 and Smpd3 are completely devoid of neutral SMase activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SMPD1 Antibody
(OTI3H7)
NBP2-45889
Immunohistochemistry SMPD1 Antibody (OTI3H7)
Immunohistochemistry SMPD1 Antibody (OTI3H7)
Immunohistochemistry SMPD1 Antibody (OTI3H7)
(4 Publications)
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(810 Publications)
Species: Hu
Applications: BA
SMPD3/NSMase2
Antibody (758612) [Un ...
MAB7184
Western Blot SMPD3/NSMase2 Antibody (758612) [Unconjugated]
(1 Review)
(1 Publication)
Species: Hu
Applications: WB
Caspase-3 Antibody
[Unconjugated] - Acti ...
AF835
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunohistochemistry Caspase-3 Antibody [Unconjugated] - Active
Immunocytochemistry Caspase-3 Antibody [Unconjugated] - Active
(7 Reviews)
(386 Publications)
Species: Hu, Mu
Applications: ICC, IHC
NSMAF Antibody
NBP1-84735
Western Blot NSMAF Antibody
Immunohistochemistry-Paraffin NSMAF Antibody
Immunocytochemistry/ Immunofluorescence NSMAF Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
TNF RI/TNFRSF1A
[HRP]
DRT100
N/A TNF RI/TNFRSF1A [HRP]
N/A TNF RI/TNFRSF1A [HRP]
N/A TNF RI/TNFRSF1A [HRP]
(86 Publications)
Species: Hu
Applications: ELISA
JNK1 Antibody
(228601) [Unconjugate
MAB17761
Western Blot JNK1 Antibody (228601) [Unconjugated]
Western Blot JNK1 Antibody (228601) [Unconjugated]
Immunocytochemistry JNK1 Antibody (228601) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
CEP110 Antibody
NBP2-48546
Immunocytochemistry/ Immunofluorescence CEP110 Antibody
Immunohistochemistry-Paraffin CEP110 Antibody
Immunohistochemistry-Paraffin CEP110 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NFkB p105/p50
Antibody (2J10D7) - B ...
NB100-56583
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
Flow Cytometry NFkB p105/p50 Antibody (2J10D7) - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, WB
BBS9 Antibody
NBP1-88927
Immunohistochemistry-Paraffin BBS9 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
SPANXB1 Antibody
H00728695-B01P
Immunocytochemistry/ Immunofluorescence SPANXB1 Antibody
Western Blot SPANXB1 Antibody
Species: Hu
Applications: ICC/IF, IP, WB
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
Immunocytochemistry/ Immunofluorescence c-Fos Antibody (2H2)
(1 Review)
(20 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
CD20 Antibody
(AISB12) - BSA Free
NBP1-43435
Western Blot CD20 Antibody (AISB12) - BSA Free
Flow Cytometry CD20 Antibody (AISB12) - BSA Free
(3 Publications)
Species: Hu, Mu
Applications: Flow, WB
PLA2G1B Antibody
(630823)
MAB5018
Western Blot PLA2G1B Antibody (630823)
Species: Hu
Applications: IP, WB
nSMase Recombinant
Protein Antigen
NBP1-87810PEP
nSMase Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for nSMase Protein (NBP1-87810PEP) (0)

There are no publications for nSMase Protein (NBP1-87810PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for nSMase Protein (NBP1-87810PEP) (0)

There are no reviews for nSMase Protein (NBP1-87810PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for nSMase Protein (NBP1-87810PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional nSMase Products

Research Areas for nSMase Protein (NBP1-87810PEP)

Find related products by research area.

Blogs on nSMase

There are no specific blogs for nSMase, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005
Caspase‑3 was detected in immersion fixed anti-FAS treated Jurkat human acute T cell leukemia cell line using 0.3 µg/mL Human/Mouse Active Caspase‑3 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF835) for 3 hours at room temperature. Cells were stained (red) and counterstained (green). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Caspase-3 Antibody [Unconjugated] - Active
AF835

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our nSMase Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol SMPD2