NRG4 Antibody Summary
Immunogen |
NRG4 (NP_612640.1, 1 a.a. - 115 a.a.) full-length human protein. MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NRG4 |
Purity |
Protein G purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
|
Application Notes |
This antibody is useful for Western Blot |
Reactivity Notes
This product is reactive against Human.
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.4) |
Preservative |
No Preservative |
Purity |
Protein G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for NRG4 Antibody
Background
The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation (Harari et al., 1999 [PubMed 10348342]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC, IHC, WB
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Species: Hu
Applications: BA
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, Neut
Species: Hu
Applications: Flow, ICC/IF, PEP-ELISA, WB
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu
Applications: ELISA, IHC, Neut, WB
Species: Mu
Applications: IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: WB
Species: Hu
Applications: ICC/IF, IP, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Publications for NRG4 Antibody (H00145957-D01P) (0)
There are no publications for NRG4 Antibody (H00145957-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for NRG4 Antibody (H00145957-D01P) (0)
There are no reviews for NRG4 Antibody (H00145957-D01P).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for NRG4 Antibody (H00145957-D01P) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional NRG4 Products
Research Areas for NRG4 Antibody (H00145957-D01P)
Find related products by research area.
|
Blogs on NRG4