![Western Blot: Nova2 Antibody [NBP2-85393] - Lanes: 1. 10 ug human neural cell lysate. 2. 10 ug human non-neural cell lysate. Primary Antibody Dilution: 1:1000. Secondary Antibody: Goat anti-rabbit IRDye 800 (1hr room temperature). Secondary Antibody Dilution: 1:15,000. Gene Name: NOVA2. Submitted by: Dr. Monica Faronato, University of Liverpool.](http://images.novusbio.com/fullsize/Nova2-Antibody-Western-Blot-NBP2-85393-img0002.jpg "Western Blot: Nova2 Antibody [NBP2-85393] - Lanes: 1. 10 ug human neural cell lysate. 2. 10 ug human non-neural cell lysate. Primary Antibody Dilution: 1:1000. Secondary Antibody: Goat anti-rabbit IRDye 800 (1hr room temperature). Secondary Antibody Dilution: 1:15,000. Gene Name: NOVA2. Submitted by: Dr. Monica Faronato, University of Liverpool.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Concentration | 1 mg/ml |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human Nova2. Peptide sequence: MEPEAPDSRKRPLETPPEVVCTKRSNTGEEGEYFLKVLIPSYAAGSIIGK The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NOVA2 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Concentration | 1 mg/ml |
| Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NOVA2 |
![Western Blot: Nova2 Antibody [NBP2-85393] - WB Suggested Anti-NOVA2 Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate](http://images.novusbio.com/fullsize/Nova2-Antibody-Western-Blot-NBP2-85393-img0001.jpg "Western Blot: Nova2 Antibody [NBP2-85393] - WB Suggested Anti-NOVA2 Antibody Titration: 1.25ug/ml. Positive Control: HepG2 cell lysate")
![Immunohistochemistry Reelin Antibody [Unconjugated]](https://images.novusbio.com/images2/Reelin_AF3820_Immunohistochemistry_18505.jpg)
![N/A VCAM-1/CD106 [HRP]](https://images.novusbio.com/images2/VCAM-1_DVC00_ELISA_206.jpg)
![N/A VCAM-1/CD106 [HRP]](https://images.novusbio.com/images2/DATA_VCAM1_DVC00_ELISA_869.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")