![Western Blot: NOP10 Antibody (6H6) [H00055505-M01-100ug] - Detection against Immunogen (32.78 KDa) .](http://images.novusbio.com/fullsize/NOP10-Antibody-6H6-Western-Blot-H00055505-M01-100ug-img0002.jpg "Western Blot: NOP10 Antibody (6H6) [H00055505-M01-100ug] - Detection against Immunogen (32.78 KDa) .")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 6H6 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Immunogen | NOP10 (NP_061118.1, 1 a.a. ~ 64 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MFLQYYLNEQGDRVYTLKKFDPMGQQTCSAHPARFSPDDKYSRHRITIKKRFKVLMTQQPRPVL |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | NOP10 |
| Purity | Protein A or G purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | Protein A or G purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NOP10 Antibody (H00055505-M01-100ug)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NOP10 |
| Entrez |
|
| OMIM |
|
| Uniprot |
|
![ELISA: NOP10 Antibody (6H6) [H00055505-M01-100ug] - Detection limit for recombinant GST tagged NOP10 is 0.1 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/NOP10-Antibody-6H6-ELISA-H00055505-M01-100ug-img0001.jpg "ELISA: NOP10 Antibody (6H6) [H00055505-M01-100ug] - Detection limit for recombinant GST tagged NOP10 is 0.1 ng/ml as a capture antibody.")
