Home » NNT » NNT Proteins » NNT Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NNT Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NNT Protein (NBP1-86512PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NNT Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NNT.

Source: E. coli

Amino Acid Sequence: ANLLKTVVTGCSCPLLSNLGSCKGLRVKKDFLRTFYTHQELWCKAPVKPGIPYKQLTVGVPKEIFQNEKRVALSPAGVQNLVKQGFNVVVESGAGEASKFSDDHYRVAGAQIQGAKEVLASDLVVKVRAPMVNPTLGVHEADLLKTSGT

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NNT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86512.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NNT Recombinant Protein Antigen

  • MGC126502
  • mitochondrial
  • nicotinamide nucleotide transhydrogenaseMGC126503
  • Pyridine nucleotide transhydrogenase

Background

NNT encodes an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification. Two alternatively spliced variants, encoding the same protein, have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ERMAP Antibody
[Unconjugated]
AF4928
Flow Cytometry ERMAP Antibody [Unconjugated]
Species: Hu
Applications: CyTOF-ready, Flow, WB
DYX1C1 Antibody
NBP1-68766
Immunohistochemistry-Paraffin DYX1C1 Antibody
Western Blot DYX1C1 Antibody
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, PEP-ELISA, WB
PEX7 Antibody
NBP1-57578
Western Blot PEX7 Antibody
(1 Publication)
Species: Hu
Applications: WB
PHYH Antibody
NBP1-87349
Western Blot PHYH Antibody
Western Blot PHYH Antibody
Immunohistochemistry-Paraffin PHYH Antibody
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NDUFB6 Antibody
NBP1-92172
Immunohistochemistry-Paraffin NDUFB6 Antibody
Western Blot NDUFB6 Antibody
Immunocytochemistry/ Immunofluorescence NDUFB6 Antibody
(2 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Prolactin Antibody
[Unconjugated]
AF1445
Neutralization Prolactin Antibody [Unconjugated]
Western Blot Prolactin Antibody [Unconjugated]
Immunohistochemistry Prolactin Antibody [Unconjugated]
(7 Publications)
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
COX-2 Antibody
NB100-689
Immunohistochemistry-Paraffin COX-2 Antibody
Simple Western COX-2 Antibody
(1 Review)
(36 Publications)
Species: Hu, Rt
Applications: IHC, IHC-Fr, IHC-P, Simple Western, WB
ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
RB1 Antibody
(607121) [Unconjugate
MAB6495
Western Blot RB1 Antibody (607121) [Unconjugated]
Immunocytochemistry RB1 Antibody (607121) [Unconjugated]
Simple Western RB1 Antibody (607121) [Unconjugated]
(5 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
SLC26A3 Antibody
NBP1-84450
Immunohistochemistry-Paraffin SLC26A3 Antibody
Immunohistochemistry-Paraffin SLC26A3 Antibody
Immunohistochemistry-Paraffin SLC26A3 Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC-WhMt, IHC, IHC-P, WB
Kallikrein 3/PSA
[HRP]
DKK300
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
N/A Kallikrein 3/PSA [HRP]
(17 Publications)
Species: Hu
Applications: ELISA
AGA Antibody
NBP1-88866
Immunohistochemistry-Paraffin AGA Antibody
Immunohistochemistry-Paraffin AGA Antibody
Immunohistochemistry-Paraffin AGA Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
CENPJ Antibody
(1A5)
H00055835-M02
Immunoprecipitation CENPJ Antibody (1A5)
Western Blot CENPJ Antibody (1A5)
Sandwich ELISA CENPJ Antibody (1A5)
Species: Hu
Applications: ELISA, IP, S-ELISA, WB
G protein alpha
inhibitor 1 Antibody ...
H00002770-M01
Western Blot G protein alpha inhibitor 1 Antibody (2B8-2A5)
Immunohistochemistry-Paraffin G protein alpha inhibitor 1 Antibody (2B8-2A5)
Sandwich ELISA G protein alpha inhibitor 1 Antibody (2B8-2A5)
(1 Publication)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
GLS2 Antibody -
BSA Free
NBP1-76544
Western Blot GLS2 Antibody - BSA Free
Immunohistochemistry GLS2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence GLS2 Antibody - BSA Free
(7 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Opsin 1 (Long
Wave) Antibody
NBP3-09392
Western Blot Opsin 1 (Long Wave) Antibody
Species: Hu, Mu
Applications: WB
S Opsin Antibody -
Azide and BSA Free
NBP1-20194
Immunohistochemistry-Paraffin S Opsin Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin S Opsin Antibody - Azide and BSA Free
Western Blot S Opsin Antibody - Azide and BSA Free
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for NNT Protein (NBP1-86512PEP) (0)

There are no publications for NNT Protein (NBP1-86512PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NNT Protein (NBP1-86512PEP) (0)

There are no reviews for NNT Protein (NBP1-86512PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NNT Protein (NBP1-86512PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NNT Products

Blogs on NNT

There are no specific blogs for NNT, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Immunohistochemistry-Paraffin: COX-2 Antibody [NB100-689] - Formalin fixed paraffin embedded colon carcinoma stained with COX-2 antibody (NB100-689).
COX-2 Antibody
NB100-689

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NNT Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NNT