I am looking to buy antibodies against most of the nicotinic receptor subunits for WB and IHC application. Could you please indicate which of your antibodies have been used by other researchers and provide publications showing their use? Thanks.

Name: Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 GST (N-Term) Protein
Brand: Novus Biologicals
SKU: H00001137-Q01
Price: 569 USD

Question

Accepted Answer

A list of our antibodies directed against he nicotinic acetylcholine receptors can be found here. Any products with publications will be indicated on the search page and can be found under the publications tab on the individual product's datasheet. Furthermore, we guarantee all of our products for the applications and species list on the datasheet. This should help narrow down your search.

At	=	A. thaliana	SyHa	=	Golden Syrian Hamster
All	=	All Species	Ha	=	Hamster
An	=	Animal	Hu	=	Human
ArHa	=	Armenian Hamster	I	=	Insect
Av	=	Avian	Ll	=	Llama
Bb	=	Baboon	Ma	=	Mammal
Ba	=	Bacteria	Mk	=	Monkey
Bv	=	Bovine	Mu	=	Mouse
Ca	=	Canine	Multi	=	Multi-species
Ce	=	C. Elegans	NA	=	Non-species specific
Ch	=	Chicken	Or	=	Orangutan
ChHa	=	Chinese Hamster	Pl	=	Plant
Cm	=	Cynomolgus Monkey	Pm	=	Primate
Do	=	Donkey	Po	=	Porcine
Dr	=	Drosophilia	Rb	=	Rabbit
Ec	=	E. Coli	Rt	=	Rat
Eq	=	Equine	RM	=	Rhesus Macaque
Fe	=	Feline	Sh	=	Sheep
Ft	=	Ferret	Vb	=	Vertebrate
Fi	=	Fish	Vi	=	Virus
Fu	=	Fungi	Xp	=	Xenopus
Ge	=	Gerbil	Ye	=	Yeast
GP	=	Guinea Pig	Ze	=	Zebrafish
Gt	=	Goat

Reactivity	HuSpecies Glossary
Applications	WB, ELISA, MA, AP

Description	A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 29-128 of Human Nicotinic Acetylcholine R alpha 4/CHRNA4 Source: Wheat Germ (in vitro) Amino Acid Sequence: HVETRAHAEERLLKKLFSGYNKWSRPVANISDVVLVRFGLSIAQLIDVDEKNQMMTTNVWVKQEWHDYKLRWDPADYENVTSIRIPSELIWRPDIVLYNN
Preparation Method	in vitro wheat germ expression system
Details of Functionality	This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source	Wheat germ
Protein/Peptide Type	Recombinant Protein
Gene	CHRNA4
Purity	>80% by SDS-PAGE and Coomassie blue staining

Dilutions	ELISA Immunoaffinity Purification Protein Array Western Blot
Theoretical MW	36.74 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Storage	Store at -80C. Avoid freeze-thaw cycles.
Buffer	50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative	No Preservative
Purity	>80% by SDS-PAGE and Coomassie blue staining

Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 GST (N-Term) Protein

Species Glossary

Images

Product Details

Order Details

Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 GST (N-Term) Protein Summary

Applications/Dilutions

Packaging, Storage & Formulations

Notes

Alternate Names for Recombinant Human Nicotinic Acetylcholine R alpha 4/CHRNA4 GST (N-Term) Protein

Background

Limitations

Customers Who Viewed This Item Also Viewed...

Publications for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01) (0)

Reviews for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01) (0)

Product General Protocols

Video Protocols

FAQs for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01). (Showing 1 - 1 of 1 FAQ).

Additional Nicotinic Acetylcholine R alpha 4/CHRNA4 Products

Research Areas for Nicotinic Acetylcholine R alpha 4/CHRNA4 Partial Recombinant Protein (H00001137-Q01)

Blogs on Nicotinic Acetylcholine R alpha 4/CHRNA4

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Review this Product

Bioinformatics