Home » NCKIPSD » NCKIPSD Proteins » NCKIPSD Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

NCKIPSD Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for NCKIPSD Recombinant Protein Antigen (NBP2-56886PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

NCKIPSD Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human NCKIPSD.

Source: E. coli

Amino Acid Sequence: RKETLSRRGPSASSVAVMTSSTSDHHLDAAAARQPNGVCRAGFERQHSLPSSEHLGADGGLYQIPLPSSQIPPQP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
NCKIPSD
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56886.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for NCKIPSD Recombinant Protein Antigen

  • 54 kDa vimentin-interacting protein
  • 90 kDa SH3 protein interacting with Nck
  • AF3p21
  • AF3P21DIP-1
  • dia interacting protein
  • Dia-interacting protein 1
  • diaphanous protein interacting protein
  • Diaphanous protein-interacting protein
  • DIP
  • DIP1
  • MGC23891
  • NCK interacting protein with SH3 domain
  • ORF1
  • SPIN90VIP54
  • WASLBP
  • WASP-interacting SH3-domain protein
  • WISHSH3 adapter protein SPIN90
  • Wisk90 kDa

Background

NCKIPSD is encoded by this gene is localized exclusively in the cell nucleus. It plays a role in signal transduction, and may function in the maintenance of sarcomeres and in the assembly of myofibrils into sarcomeres. It also plays an important role in stress fiber formation. The gene is involved in therapy-related leukemia by a chromosomal translocation t(3;11)(p21;q23) that involves this gene and the myeloid/lymphoid leukemia gene. Alternative splicing occurs in this locus and two transcript variants encoding distinct isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CapG Antibody
NBP1-90214
Immunocytochemistry/ Immunofluorescence CapG Antibody
Western Blot CapG Antibody
Immunohistochemistry-Paraffin CapG Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
CD46 Antibody
(344519) [Unconjugate
MAB2005
N/A CD46 Antibody (344519) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
WASP Antibody
NB300-996
Immunohistochemistry-Paraffin WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
ASZ1 Antibody -
Azide and BSA Free
NBP2-92863
Immunocytochemistry/ Immunofluorescence ASZ1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence ASZ1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin ASZ1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(808 Publications)
Species: Hu
Applications: BA
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
PMEL17/SILV
Antibody (HMB45)
NBP2-44520
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Flow (Intracellular) PMEL17/SILV Antibody (HMB45)
Immunohistochemistry PMEL17/SILV Antibody (HMB45)
(8 Publications)
Species: Ca(-), Hu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, IF, IHC, IHC-P, MI, WB
CTTNBP2 Antibody
NBP2-32030
Immunohistochemistry-Paraffin CTTNBP2 Antibody
Immunohistochemistry-Paraffin CTTNBP2 Antibody
Immunohistochemistry-Paraffin CTTNBP2 Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Catalase Antibody
[Unconjugated]
AF3398
Western Blot Catalase Antibody [Unconjugated]
Simple Western Catalase Antibody [Unconjugated]
Knockout Validated Catalase Antibody [Unconjugated]
(3 Reviews)
(15 Publications)
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(795 Publications)
Species: Hu
Applications: BA
CRAT Antibody
NBP1-86616
Western Blot CRAT Antibody
Western Blot CRAT Antibody
Immunohistochemistry-Paraffin CRAT Antibody
(2 Publications)
Species: Hu
Applications: IHC, IHC-P, WB
GLYAT Antibody
NBP2-58917
Western Blot GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Immunohistochemistry-Paraffin GLYAT Antibody
Species: Hu
Applications: IHC, IHC-P, WB
GRIP1 Antibody -
BSA Free
NBP2-41211
Western Blot GRIP1 Antibody - BSA Free
Immunohistochemistry GRIP1 Antibody - BSA Free
Immunohistochemistry GRIP1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
IFN-alpha 1
Antibody
NBP2-75930
Western Blot IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Immunocytochemistry/ Immunofluorescence IFN-alpha 1 Antibody
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
PUM3 Antibody
NBP1-57531
Western Blot PUM3 Antibody
Immunohistochemistry-Paraffin PUM3 Antibody
Immunohistochemistry PUM3 Antibody
Species: Hu
Applications: IHC, IHC-P, WB

Publications for NCKIPSD Recombinant Protein Antigen (NBP2-56886PEP) (0)

There are no publications for NCKIPSD Recombinant Protein Antigen (NBP2-56886PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for NCKIPSD Recombinant Protein Antigen (NBP2-56886PEP) (0)

There are no reviews for NCKIPSD Recombinant Protein Antigen (NBP2-56886PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for NCKIPSD Recombinant Protein Antigen (NBP2-56886PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional NCKIPSD Products

Blogs on NCKIPSD

There are no specific blogs for NCKIPSD, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our NCKIPSD Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol NCKIPSD