![Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human kidney.](http://images.novusbio.com/fullsize/Napsin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-34213-img0006.jpg "Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human kidney.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SDPAHYIPPLTFVPVTVPAYWQIHMERVKVG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NAPSA |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for Napsin A Antibody (NBP2-34213)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human lung shows strong cytoplasmic positivity in pneumocytes and macrophages.](http://images.novusbio.com/fullsize/Napsin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-34213-img0001.jpg "Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human lung shows strong cytoplasmic positivity in pneumocytes and macrophages.")
![Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human placenta shows low expression as expected.](http://images.novusbio.com/fullsize/Napsin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-34213-img0002.jpg "Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human placenta shows low expression as expected.")
![Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining in human lung and placenta tissues using anti-NAPSA antibody. Corresponding NAPSA RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/Napsin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-34213-img0003.jpg "Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining in human lung and placenta tissues using anti-NAPSA antibody. Corresponding NAPSA RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human colon, kidney, lung and lymph node using Anti-NAPSA antibody NBP2-34213 (A) shows similar protein distribution across tissues to independent antibody NBP2-34212 (B).](http://images.novusbio.com/fullsize/Napsin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-34213-img0004.jpg "Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human colon, kidney, lung and lymph node using Anti-NAPSA antibody NBP2-34213 (A) shows similar protein distribution across tissues to independent antibody NBP2-34212 (B).")
![Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human lymph node.](http://images.novusbio.com/fullsize/Napsin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-34213-img0005.jpg "Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human lymph node.")
![Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human colon.](http://images.novusbio.com/fullsize/Napsin-A-Antibody-Immunohistochemistry-Paraffin-NBP2-34213-img0007.jpg "Immunohistochemistry-Paraffin: Napsin A Antibody [NBP2-34213] - Staining of human colon.")
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")