Napsin A Antibody Summary
Immunogen |
This antibody was developed against a recombinant protein corresponding to amino acids: GTKFAIQYGTGRVDGILSEDKLTIGGIKGASVIFGEALWEPSLVF |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
NAPSA |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (82%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Napsin A Antibody
Background
Napsin is a pepsin-like aspartic proteinase, in the A1 clan of the AA clade of proteinases. Other AA family proteinases include Pepsin, cathepsin-D, cathepsin-E and rennin. Of these proteinases, napsin is most closely related to cathepsin-D, sharing 46% identity at the amino acid level. There are two closely related Napsins, napsin A and napsin B, with 85% overall identity at the amino acid level. There are three isoforms. Napsin-A is also termed napsin-1, or TA02, a Tumor Adenocarcinoma marker. Napsin A may be involved in processing of pneumocyte surfactant precursors.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Rt
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: PAGE
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Publications for Napsin A Antibody (NBP2-33499) (0)
There are no publications for Napsin A Antibody (NBP2-33499).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Napsin A Antibody (NBP2-33499) (0)
There are no reviews for Napsin A Antibody (NBP2-33499).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Napsin A Antibody (NBP2-33499) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Napsin A Products
Research Areas for Napsin A Antibody (NBP2-33499)
Find related products by research area.
|
Blogs on Napsin A