![Western Blot: NAP1L1 Antibody (4W8B6) [NBP3-16633] - Western blot analysis of extracts of various cell lines, using NAP1L1 Rabbit mAb (NBP3-16633) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/NAP1L1-Antibody-4W8B6-Western-Blot-NBP3-16633-img0004.jpg "Western Blot: NAP1L1 Antibody (4W8B6) [NBP3-16633] - Western blot analysis of extracts of various cell lines, using NAP1L1 Rabbit mAb (NBP3-16633) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF |
| Clone | 4W8B6 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human NAP1L1 (P55209). MADIDNKEQSELDQDLDDVEEVEEEETGEETKLKARQLTVQMMQNPQILAALQERLDGLVETPTGYIESLPRVVKRRVNALKNLQVKCAQIEAKFYEEVH |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | NAP1L1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21496.jpg)
![Immunohistochemistry Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Immunohistochemistry_21497.jpg)
![Western Blot Neuropilin-1 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin1_AF566_Western_Blot_21557.jpg)
![Neutralization CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Block_Neutralize_9064.jpg)
![Immunocytochemistry CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/CXCL8_MAB208_Immunocytochemistry_9339.jpg)
![Western Blot CXCL8/IL-8 Antibody (6217) [Unconjugated]](https://images.novusbio.com/images2/mab208_human-il-8-cxcl8-mab-clone-6217-western-blot-1882021143847.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for NAP1L1 Antibody (NBP3-16633)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NAP1L1 |
![Immunocytochemistry/Immunofluorescence: NAP1L1 Antibody (4W8B6) [NBP3-16633] - Immunofluorescence analysis of U-2 OS cells using NAP1L1 Rabbit mAb (NBP3-16633) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/NAP1L1-Antibody-4W8B6-Immunocytochemistry-Immunofluorescence-NBP3-16633-img0003.jpg "Immunocytochemistry/Immunofluorescence: NAP1L1 Antibody (4W8B6) [NBP3-16633] - Immunofluorescence analysis of U-2 OS cells using NAP1L1 Rabbit mAb (NBP3-16633) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Western Blot: NAP1L1 Antibody (4W8B6) [NBP3-16633] - Western blot analysis of extracts of various cell lines, using NAP1L1 Rabbit mAb (NBP3-16633) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.](http://images.novusbio.com/fullsize/NAP1L1-Antibody-4W8B6-Western-Blot-NBP3-16633-img0005.jpg "Western Blot: NAP1L1 Antibody (4W8B6) [NBP3-16633] - Western blot analysis of extracts of various cell lines, using NAP1L1 Rabbit mAb (NBP3-16633) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1min.")
![Immunocytochemistry/Immunofluorescence: NAP1L1 Antibody (4W8B6) [NBP3-16633] - Immunofluorescence analysis of C6 cells using NAP1L1 Rabbit mAb (NBP3-16633) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/NAP1L1-Antibody-4W8B6-Immunocytochemistry-Immunofluorescence-NBP3-16633-img0001.jpg "Immunocytochemistry/Immunofluorescence: NAP1L1 Antibody (4W8B6) [NBP3-16633] - Immunofluorescence analysis of C6 cells using NAP1L1 Rabbit mAb (NBP3-16633) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunocytochemistry/Immunofluorescence: NAP1L1 Antibody (4W8B6) [NBP3-16633] - Immunofluorescence analysis of NIH-3T3 cells using NAP1L1 Rabbit mAb (NBP3-16633) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/NAP1L1-Antibody-4W8B6-Immunocytochemistry-Immunofluorescence-NBP3-16633-img0002.jpg "Immunocytochemistry/Immunofluorescence: NAP1L1 Antibody (4W8B6) [NBP3-16633] - Immunofluorescence analysis of NIH-3T3 cells using NAP1L1 Rabbit mAb (NBP3-16633) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Immunohistochemistry Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Immunohistochemistry_16084.jpg)
![Western Blot Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Western_Blot_20048.jpg)
![Simple Western Neuropilin-2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Neuropilin2_AF567_Simple_Western_20049.jpg)
![Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]](https://images.novusbio.com/images2/Angiopoietinlike_Protein_2_AF1444_Western_Blot_19840.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")