Novus Biologicals products are now on bio-techne.com

Myosin Phosphatase Recombinant Protein Antigen

Images

 
There are currently no images for Myosin Phosphatase Recombinant Protein Antigen (NBP2-58950PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Myosin Phosphatase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Myosin Phosphatase.

Source: E. coli

Amino Acid Sequence: GVSFWTQDSDENEQEQQSDTEEGSNKKETQTDSISRYETSSTSAGDRYDSLLGRSGSYSYLEERKPYSSRLEKDDSTDFKKLYEQILAENEELK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PPP1R12A
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-58950.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Myosin Phosphatase Recombinant Protein Antigen

  • MBSmyosin phosphatase, target subunit 1
  • MGC133042
  • Myosin phosphatase target subunit 1
  • Myosin phosphatase-targeting subunit 1
  • MYPT1protein phosphatase 1 regulatory subunit 12A
  • protein phosphatase 1, regulatory (inhibitor) subunit 12A
  • Protein phosphatase myosin-binding subunit

Background

The major protein phosphatase-1 (PP1) is composed of 3 subunits with apparent molecular mass of 110-130, 37 & 20 kDa. The 110-130 kDa component act as a regulatory subunit known as myosine binding (MBS) or myosine phosphatae targeting subunit (MYPT). The N-terminal portion of MYPT binds to both PP1c-delta and phosphorylated myosin, thereby increasing myosin phosphatase activity. Two isoform of MYPT have been identified (MYPT1 & MYPT2) and share 61% sequence identity. While MYPT1 is widely distributed in human tissues, MYPT2 is mostly detected in brain and heart.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37897
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-58359
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-59690
Species: Am, Av, Fi, Ma, Ze
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IP, WB
NBP1-81555
Species: Hu
Applications: IHC, IHC-P, WB
NB100-91273
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
G-125-C
Species: Hu
Applications:
NBP2-82026
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB100-624
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-62682
Species: Hu
Applications: IHC, IHC-P
NBP2-67486
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB1417
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
NBP1-31348
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00085366-M01
Species: Hu, Mu
Applications: ELISA, KD, WB
MAB4470
Species: All-Multi
Applications: ICC, IHC, WB
NBP2-14843
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for Myosin Phosphatase Recombinant Protein Antigen (NBP2-58950PEP) (0)

There are no publications for Myosin Phosphatase Recombinant Protein Antigen (NBP2-58950PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Myosin Phosphatase Recombinant Protein Antigen (NBP2-58950PEP) (0)

There are no reviews for Myosin Phosphatase Recombinant Protein Antigen (NBP2-58950PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Myosin Phosphatase Recombinant Protein Antigen (NBP2-58950PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Myosin Phosphatase Products

Research Areas for Myosin Phosphatase Recombinant Protein Antigen (NBP2-58950PEP)

Find related products by research area.

Blogs on Myosin Phosphatase

There are no specific blogs for Myosin Phosphatase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Myosin Phosphatase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP1R12A