![Western Blot: MYBBP1A Antibody [NBP2-13630] - Analysis in human cell line HEK 293 and human cell line SK-MEL-30.](http://images.novusbio.com/fullsize/MYBBP1A-Antibody-Western-Blot-NBP2-13630-img0010.jpg "Western Blot: MYBBP1A Antibody [NBP2-13630] - Analysis in human cell line HEK 293 and human cell line SK-MEL-30.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the amino acids: EDLPLCSILQQIQEKYDLHQVKKAMLRPALFANLFGVLALFQSGRLVKDQEALMKSVKLLQALAQYQNHLQEQPRKALVDILSEVSKATLQEILPEVLKADLNIILSSPEQLELFLLAQQKVPSKLKKLVG |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MYBBP1A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. For ICC/IF Fixation/Permeabilization: PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MYBBP1A |
![Immunocytochemistry/Immunofluorescence: MYBBP1A Antibody [NBP2-13630] - Staining of human cell line U-2 OS shows positivity in nucleoli and vesicles. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MYBBP1A-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-13630-img0003.jpg "Immunocytochemistry/Immunofluorescence: MYBBP1A Antibody [NBP2-13630] - Staining of human cell line U-2 OS shows positivity in nucleoli and vesicles. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: MYBBP1A Antibody [NBP2-13630] - Staining of human liver shows no positivity in nucleoli in hepatocytes as expected.](http://images.novusbio.com/fullsize/MYBBP1A-Antibody-Immunohistochemistry-Paraffin-NBP2-13630-img0009.jpg "Immunohistochemistry-Paraffin: MYBBP1A Antibody [NBP2-13630] - Staining of human liver shows no positivity in nucleoli in hepatocytes as expected.")
![Immunohistochemistry-Paraffin: MYBBP1A Antibody [NBP2-13630] - Analysis in human skin and liver. Corresponding RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MYBBP1A-Antibody-Immunohistochemistry-Paraffin-NBP2-13630-img0006.jpg "Immunohistochemistry-Paraffin: MYBBP1A Antibody [NBP2-13630] - Analysis in human skin and liver. Corresponding RNA-seq data are presented for the same tissues.")
![Immunohistochemistry-Paraffin: MYBBP1A Antibody [NBP2-13630] - Staining of human skin shows strong positivity in nucleoli in epidermal cells.](http://images.novusbio.com/fullsize/MYBBP1A-Antibody-Immunohistochemistry-Paraffin-NBP2-13630-img0007.jpg "Immunohistochemistry-Paraffin: MYBBP1A Antibody [NBP2-13630] - Staining of human skin shows strong positivity in nucleoli in epidermal cells.")
![Immunohistochemistry-Paraffin: MYBBP1A Antibody [NBP2-13630] - Staining of human cerebral cortex shows strong positivity in nucleoli in neurons.](http://images.novusbio.com/fullsize/MYBBP1A-Antibody-Immunohistochemistry-Paraffin-NBP2-13630-img0008.jpg "Immunohistochemistry-Paraffin: MYBBP1A Antibody [NBP2-13630] - Staining of human cerebral cortex shows strong positivity in nucleoli in neurons.")
![Western Blot CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/CBP_MAB2676_Western_Blot_6043.jpg)
![Immunocytochemistry CBP/KAT3A Antibody (257003) [Unconjugated]](https://images.novusbio.com/images2/mab2676_human-mouse-rat-cbp-mab-clone-257003-immunocytochemistry-101220208237.jpg)
![Western Blot Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) - BSA Free](https://images.novusbio.com/images/Androgen-R-NR3C4-p-Ser213-p-Ser210-Antibody-156C135-2-Western-Blot-NB100-56603-img0004.jpg)
![Simple Western PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Simple_Western_16616.jpg)
![Western Blot PAG1 Antibody (504004) [Unconjugated]](https://images.novusbio.com/images2/PAG1_MAB5285_Western_Blot_9455.jpg)
![Western Blot eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Western-Blot-NB100-81898-img0009.jpg)
![Immunocytochemistry/ Immunofluorescence eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunocytochemistry-Immunofluorescence-NB100-81898-img0005.jpg)
![Immunohistochemistry-Paraffin eIF4E [p Ser209] Antibody](https://images.novusbio.com/images/eIF4E-[p-Ser209]-Antibody-Immunohistochemistry-NB100-81898-img0006.jpg)
![Western Blot Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Western_Blot_5209.jpg)
![Simple Western Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/16327.jpg)
![Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]](https://images.novusbio.com/images2/Src_AF2685_Immunohistochemistry_7158.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")