Home » Muscle Phosphofructokinase/PFKM/PFK-1 » PFK-1 Peptides and Proteins » Muscle Phosphofructokinase/PFKM/PFK-1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

Muscle Phosphofructokinase/PFKM/PFK-1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

Muscle Phosphofructokinase/PFKM/PFK-1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PFKM.

Source: E. coli

Amino Acid Sequence: CVQVTKDVTKAMDEKKFDEALKLRGRSFMNNWEVYKLLAHVRPPVSKSGSHTVAVMNVGAPAAGMNAAVRSTVRIGLIQGNRVLVVHDGFEGLAKGQIEEAGWSYVGGWTGQGGSKLGTKRTLPKKSFEQISA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
PFKM
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-87293.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Muscle Phosphofructokinase/PFKM/PFK-1 Recombinant Protein Antigen

  • 6-phosphofructokinase, muscle type
  • EC 2.7.1,6-phosphofructo-1-kinase
  • EC 2.7.1.11
  • GSD7
  • MGC8699
  • Muscle Phosphofructokinase
  • PFK1
  • PFK-1
  • PFKA
  • PFK-A
  • PFKM
  • PFKX
  • Phosphofructo-1-kinase isozyme A
  • Phosphofructokinase 1
  • phosphofructokinase, muscle
  • phosphofructokinase, polypeptide X
  • Phosphofructokinase-1
  • Phosphofructokinase-M
  • Phosphohexokinase

Background

Phosphofructokinases (PFK) are regulatory glycolytic enzymes that convert fructose 6-phosphate and ATP into fructose 1,6-bisphosphate (through PFK-1), fructose 2,6-bisphosphate (through PFK-2) and ADP. Human PFK-1 is tetrameric and isoenzymes include PFK-1 muscle (PFKM, PFK-A), PFK-1 liver (PFKL, PFK-B) and PFK-1 platelet (PFKP, PFK-C, PFKF). PFK-1 is inhibited by ATP and citrate (from the tricarboxylic acid cycle). PFK-1 undergoes activation in the presence of elevated AMP. The most potent activator is fructose 2,6-bisphosphate, which is produced by PFK-2 from the same substrate, fructose 6-phosphate. PFK-2 is bifunctional and a key regulator for PFK-1. PFK-2 catalyzes the synthesis of fructose 2,6-bisphosphate and contains fructose 2,6-biphosphatase activity that catalyzes the degradation of fructose 2,6-bisphosphate. PFK-2 is dimeric and isoenzymes include PFK-2 liver (PFKFB1, PFRX), PFK-2 cardiac (PFKFB2), PFK-2 placental (PFKFB3, inducible PFK-2) and PFK-2 testis (PFKFB4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

6 Phosphofructo 2
Kinase Antibody (3F3)
H00005209-M08
Western Blot 6 Phosphofructo 2 Kinase Antibody (3F3)
ELISA 6 Phosphofructo 2 Kinase Antibody (3F3)
Western Blot 6 Phosphofructo 2 Kinase Antibody (3F3)
(1 Review)
(16 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, IP, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Hexokinase 1
Antibody (ST47-05)
NBP2-67503
Immunocytochemistry/ Immunofluorescence Hexokinase 1 Antibody (ST47-05)
Immunocytochemistry/ Immunofluorescence Hexokinase 1 Antibody (ST47-05)
Immunohistochemistry-Paraffin Hexokinase 1 Antibody (ST47-05)
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
Glucose 6
phosphate isomerase A ...
NBP2-02541
Western Blot Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
Immunohistochemistry-Paraffin Glucose 6 phosphate isomerase Antibody (OTI2D2)
(1 Publication)
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Glucokinase/GCK
Antibody (OTI3E3)
NBP1-47778
Immunocytochemistry/ Immunofluorescence Glucokinase/GCK Antibody (OTI3E3)
Immunohistochemistry-Paraffin Glucokinase/GCK Antibody (OTI3E3)
Immunohistochemistry-Paraffin Glucokinase/GCK Antibody (OTI3E3)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Prothrombin
Antibody
NBP1-58268
Immunohistochemistry-Paraffin Prothrombin Antibody
Immunohistochemistry-Paraffin Prothrombin Antibody
Western Blot Prothrombin Antibody
(1 Review)
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TTF2 Antibody (1E8)
H00008458-M06
Immunocytochemistry/ Immunofluorescence TTF2 Antibody (1E8)
Western Blot TTF2 Antibody (1E8)
Western Blot TTF2 Antibody (1E8)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Glucagon Antibody
(181402) [Unconjugate ...
MAB1249
Immunocytochemistry Glucagon Antibody (181402) [Unconjugated]
Intracellular Staining by Flow Cytometry Glucagon Antibody (181402) [Unconjugated]
(1 Review)
(14 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
Glut1 Antibody -
BSA Free
NB110-39113
Western Blot Glut1 Antibody - BSA Free
Flow Cytometry Glut1 Antibody - BSA Free
Western Blot Glut1 Antibody - BSA Free
(7 Reviews)
(62 Publications)
Species: Hu, Mu, Rb, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, Simple Western, WB
Biglycan Antibody
AF2667
Immunohistochemistry Biglycan Antibody
Immunocytochemistry/ Immunofluorescence Biglycan Antibody
(17 Publications)
Species: Hu
Applications: IHC, WB
Calmodulin 3
Antibody
NBP2-15669
Western Blot Calmodulin 3 Antibody
Western Blot Calmodulin 3 Antibody
Immunohistochemistry Whole-Mount Calmodulin 3 Antibody
(1 Publication)
Species: Mu, Rt, Ze
Applications: IHC-WhMt, IHC, WB
Calmodulin 2
Antibody
NBP2-14871
Immunocytochemistry/ Immunofluorescence Calmodulin 2 Antibody
Western Blot Calmodulin 2 Antibody
(1 Publication)
Species: Mu, Rt
Applications: ICC/IF, WB
Calmodulin
Antibody (2D1) - BSA
NB120-2860
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
Immunocytochemistry/ Immunofluorescence Calmodulin Antibody (2D1) - BSA Free
(3 Publications)
Species: Ba, Bv, Ch, Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Glucose 6
Phosphate Dehydrogena ...
NB100-236
Immunoprecipitation Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
Western Blot Glucose 6 Phosphate Dehydrogenase Antibody
(19 Publications)
Species: Hu, Mu
Applications: IB, IHC, IHC-Fr, IP, WB
Triosephosphate
isomerase Antibody
NBP1-31470
Western Blot Triosephosphate isomerase Antibody
Western Blot Triosephosphate isomerase Antibody
Immunocytochemistry/ Immunofluorescence Triosephosphate isomerase Antibody
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Hexokinase 2
Antibody (OTI4C5)
NBP2-02272
Flow Cytometry Hexokinase 2 Antibody (OTI4C5)
Immunocytochemistry/ Immunofluorescence Hexokinase 2 Antibody (OTI4C5)
Immunocytochemistry/ Immunofluorescence Hexokinase 2 Antibody (OTI4C5)
(5 Publications)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, WB
PFKFB2 Antibody
NBP1-45238
Immunohistochemistry-Paraffin PFKFB2 Antibody
(1 Publication)
Species: Bv, Ca, Hu
Applications: IHC, IHC-P, PEP-ELISA, WB

Publications for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP) (0)

There are no publications for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP) (0)

There are no reviews for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Muscle Phosphofructokinase/PFKM/PFK-1 Products

Research Areas for Muscle Phosphofructokinase/PFKM/PFK-1 Protein (NBP1-87293PEP)

Find related products by research area.

Blogs on Muscle Phosphofructokinase/PFKM/PFK-1

There are no specific blogs for Muscle Phosphofructokinase/PFKM/PFK-1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: Glut1 Antibody [NB110-39113] - Glut1 in human brain lysate (55 kDa). Antibody at 1:500. Western blot image submitted by a verified customer review.
Glut1 Antibody - BSA Free
NB110-39113

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Muscle Phosphofructokinase/PFKM/PFK-1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol PFKM