Home » MTF1 » MTF1 Proteins » MTF1 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MTF1 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MTF1 Protein (NBP1-86379PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MTF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MTF1.

Source: E. coli

Amino Acid Sequence: HLPFLVGGEEGFHLIDHEAMSQGYVQHIISPDQIHLTINPGSTPMPRNIEGATLTLQSECPETKRKEVK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MTF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86379.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MTF1 Recombinant Protein Antigen

  • metal regulatory transcription factor 1
  • metal-regulatory transcription factor 1
  • metal-responsive transcription factor 1
  • MGC23036
  • MRE-binding transcription factor
  • MRE-binding transcription factor-1
  • MTF-1
  • Transcription factor MTF-1
  • zinc regulatory factor
  • ZRF

Background

MTF1 encodes a transcription factor that induces expression of metallothioneins and other genes involved in metal homeostasis in response to heavy metals such as cadmium, zinc, copper, and silver. The protein is a nucleocytoplasmic shuttling protein that accumulates in the nucleus upon heavy metal exposure and binds to promoters containing a metal-responsive element (MRE).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MCAT Antibody (2F2)
H00027349-M01
Immunohistochemistry-Paraffin MCAT Antibody (2F2)
Western Blot MCAT Antibody (2F2)
Sandwich ELISA MCAT Antibody (2F2)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
SLC30A1 Antibody -
BSA Free
NBP2-95127
Immunohistochemistry-Paraffin SLC30A1 Antibody - BSA Free
Western Blot SLC30A1 Antibody - BSA Free
Immunohistochemistry-Paraffin SLC30A1 Antibody - BSA Free
Species: Hu, Rt
Applications: IHC, IHC-P, WB
SP1 Antibody
NB600-232
Western Blot SP1 Antibody
Immunohistochemistry-Paraffin SP1 Antibody
Western Blot SP1 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
COCO/DAND5
[Unconjugated]
3047-CC
COCO/DAND5 [Unconjugated]
(4 Publications)
Species: Hu
Applications: BA
PSG1 [HRP]
DPSG10
N/A PSG1 [HRP]
N/A PSG1 [HRP]
(2 Publications)
Species: Hu
Applications: ELISA
c-jun [p Ser63]
Antibody (1018Y) [Unc ...
MAB8930
Western Blot c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Immunocytochemistry c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
Simple Western c-jun [p Ser63] Antibody (1018Y) [Unconjugated]
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, Simple Western, WB
Metallothionein-2A
Antibody (6G2)
H00004502-M01
ELISA Metallothionein-2A Antibody (6G2)
Immunocytochemistry/ Immunofluorescence Metallothionein-2A Antibody (6G2)
(3 Publications)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, WB
Nrf2 Antibody
NBP1-32822
Western Blot Nrf2 Antibody
Western Blot Nrf2 Antibody
Western Blot Nrf2 Antibody
(4 Reviews)
(71 Publications)
Species: Al, Av, Hu, Mu, Pl, Rt, Ze
Applications: ChIP, Flow, ICC/IF, IHC, IHC-P, IP, KD, Simple Western, WB
PLGF [HRP]
DPG00
N/A PLGF [HRP]
N/A PLGF [HRP]
N/A PLGF [HRP]
(79 Publications)
Species: Hu
Applications: ELISA
HO-1/HMOX1/HSP32
Antibody (HO-1-1)
NBP1-97507
Flow Cytometry HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Immunohistochemistry-Paraffin HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Western Blot HO-1/HMOX1/HSP32 Antibody (HO-1-1)
(1 Review)
(20 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
HIF-1 alpha
Antibody (H1alpha67)
NB100-105
Western Blot HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
Flow Cytometry HIF-1 alpha Antibody (H1alpha67)
(45 Reviews)
(1040 Publications)
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
GCLC Antibody (3H1)
H00002729-M01
ELISA GCLC Antibody (3H1)
Western Blot GCLC Antibody (3H1)
Immunocytochemistry/ Immunofluorescence GCLC Antibody (3H1)
(17 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
KAT3B/p300
Antibody (RW105) - BS
NB100-616
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
Flow Cytometry KAT3B/p300 Antibody (RW105) - BSA Free
Immunocytochemistry/ Immunofluorescence KAT3B/p300 Antibody (RW105) - BSA Free
(13 Publications)
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
Recombinant Human
Metallothionein-1A GS ...
H00004489-P01
SDS-PAGE Recombinant Human Metallothionein-1A GST (N-Term) Protein
(1 Publication)
Species: Hu
Applications: ELISA, AP, PA, WB
MTF1 Recombinant
Protein Antigen
NBP1-86379PEP
MTF1 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MTF1 Protein (NBP1-86379PEP) (0)

There are no publications for MTF1 Protein (NBP1-86379PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTF1 Protein (NBP1-86379PEP) (0)

There are no reviews for MTF1 Protein (NBP1-86379PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MTF1 Protein (NBP1-86379PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MTF1 Products

Blogs on MTF1

There are no specific blogs for MTF1, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Naive CD4 T cells from WT, VHL-deficient (Vhl KO), or HIF-1 alpha-deficient (HIF-1 alpha KO) mice were differentiated under IL-22-skewing conditions for a total of 60 h. Some cells remained at normoxia for the duration of the culture (N); others were at normoxia for 35 h and then hypoxia (1% O2) for 24 h (H). At 60 h, nuclear extracts were harvested, and HIF-1 alpha and Lamin B1 levels were analyzed by Western blot. Image from verified customer review.
HIF-1 alpha Antibody (H1alpha67)
NB100-105
Untreated (-) and treated (+) RAW264.7 whole cell extracts (30 ug) were separated by 5% SDS-PAGE, and the membrane was blotted with NRF2 antibody [N2C2], Internal diluted at 1:500. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Nrf2 Antibody
NBP1-32822

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MTF1 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MTF1