![Western Blot: MTCO1 Antibody [NBP2-94458] - Analysis of extracts of various cell lines, using MTCO1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.](http://images.novusbio.com/fullsize/MTCO1-Antibody-Western-Blot-NBP2-94458-img0012.jpg "Western Blot: MTCO1 Antibody [NBP2-94458] - Analysis of extracts of various cell lines, using MTCO1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ELISA, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | Azide and BSA Free |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 400-500 of human MTCO1 (YP_002124304.1). FSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPP |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | COX1 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Theoretical MW | 57 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol |
| Preservative | 0.05% Proclin 300 |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for MTCO1 Antibody (NBP2-94458)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | COX1 |
![Immunohistochemistry: MTCO1 Antibody - Azide and BSA Free [NBP2-94458] - Immunohistochemistry analysis of paraffin-embedded rat brain using MTCO1 Rabbit pAb (A17889) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/nbp2-94458_rabbit-polyclonal-mtco1-antibody-52202519302978.jpg "Immunohistochemistry: MTCO1 Antibody - Azide and BSA Free [NBP2-94458] - Immunohistochemistry analysis of paraffin-embedded rat brain using MTCO1 Rabbit pAb (A17889) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunocytochemistry/ Immunofluorescence: MTCO1 Antibody - Azide and BSA Free [NBP2-94458] - Immunofluorescence analysis of PC-12 cells using MTCO1 Rabbit pAb (A17889) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.](http://images.novusbio.com/fullsize/nbp2-94458_rabbit-polyclonal-mtco1-antibody-52202519313440.jpg "Immunocytochemistry/ Immunofluorescence: MTCO1 Antibody - Azide and BSA Free [NBP2-94458] - Immunofluorescence analysis of PC-12 cells using MTCO1 Rabbit pAb (A17889) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.")
![Immunohistochemistry: MTCO1 Antibody - Azide and BSA Free [NBP2-94458] - Immunohistochemistry analysis of paraffin-embedded rat kidney using MTCO1 Rabbit pAb (A17889) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/nbp2-94458_rabbit-polyclonal-mtco1-antibody-52202519313412.jpg "Immunohistochemistry: MTCO1 Antibody - Azide and BSA Free [NBP2-94458] - Immunohistochemistry analysis of paraffin-embedded rat kidney using MTCO1 Rabbit pAb (A17889) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry: MTCO1 Antibody - Azide and BSA Free [NBP2-94458] - Immunohistochemistry analysis of paraffin-embedded mouse heart using MTCO1 Rabbit pAb (A17889) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/nbp2-94458_rabbit-polyclonal-mtco1-antibody-522025193134.jpg "Immunohistochemistry: MTCO1 Antibody - Azide and BSA Free [NBP2-94458] - Immunohistochemistry analysis of paraffin-embedded mouse heart using MTCO1 Rabbit pAb (A17889) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry: MTCO1 Antibody - Azide and BSA Free [NBP2-94458] - Immunohistochemistry analysis of paraffin-embedded mouse kidney using MTCO1 Rabbit pAb (A17889) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/nbp2-94458_rabbit-polyclonal-mtco1-antibody-52202519302999.jpg "Immunohistochemistry: MTCO1 Antibody - Azide and BSA Free [NBP2-94458] - Immunohistochemistry analysis of paraffin-embedded mouse kidney using MTCO1 Rabbit pAb (A17889) at dilution of 1:100 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")