Home » MSPR/Ron » MSPR/Ron Proteins » MSPR/Ron Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MSPR/Ron Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MSPR/Ron Recombinant Protein Antigen (NBP1-88136PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

MSPR/Ron Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MST1R.

Source: E. coli

Amino Acid Sequence: EDPVVLSISPNCGYINSHITICGQHLTSAWHLVLSFHDGLRAVESRCERQLPEQQLCRLPEYVVRDPQGWVAGNLSARGDGAAGFTLPGFRFLPPPHPPSANLVPLKP

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MST1R
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-88136.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MSPR/Ron Recombinant Protein Antigen

  • CD136 antigen
  • CD136
  • CDw136c-met-related tyrosine kinase
  • EC 2.7.10
  • EC 2.7.10.1
  • macrophage stimulating 1 receptor (c-met-related tyrosine kinase)
  • MSP R
  • MSP receptor
  • MSPR
  • MST1R
  • p185-Ron
  • Protein-tyrosine kinase 8
  • PTK8 protein tyrosine kinase 8
  • PTK8
  • Ron
  • RONmacrophage-stimulating protein receptor
  • soluble RON variant 1
  • soluble RON variant 2
  • soluble RON variant 3
  • soluble RON variant 4

Background

Ron, the tyrosine kinase receptor for the Macrophage-stimulating protein, is involved in cell dissociation, motility, and matrix invasion (1). Ron, a cDNA homologous to the hepatocyte growth factor (HGF) receptor gene (MET), encodes a putative tyrosine kinase. It has been shown that the Ron gene is expressed in several epithelial tissues as well as in granulocytes and monocytes. The major RON transcript is translated into a glycosylated single chain precursor, cleaved into a 185 kDa heterodimer (p185Ron) of 35 (alpha) and 150 kDa (beta) disulfide-linked chains, before exposure at the cell surface (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MSP/MST1
[Unconjugated]
352-MS
MSP/MST1 [Unconjugated]
(9 Publications)
Species: Hu
Applications: BA, BA
HGF [Unconjugated]
294-HG
Bioactivity HGF [Unconjugated]
Cell Culture HGF [Unconjugated]
(111 Publications)
Species: Hu
Applications: BA
HGFR/c-MET
Antibody [Unconjugate
AF276
Immunocytochemistry HGFR/c-MET Antibody [Unconjugated]
Immunohistochemistry HGFR/c-MET Antibody [Unconjugated]
Knockout Validated HGFR/c-MET Antibody [Unconjugated]
(1 Review)
(53 Publications)
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
Recombinant Human
TMPRSS13 GST (N-Term) ...
H00084000-Q01
SDS-PAGE Recombinant Human TMPRSS13 GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
PSP94/MSMB
Antibody (OTI6C7)
NBP2-02450
Western Blot PSP94/MSMB Antibody (OTI6C7)
Immunocytochemistry/ Immunofluorescence PSP94/MSMB Antibody (OTI6C7)
Immunohistochemistry-Paraffin PSP94/MSMB Antibody (OTI6C7)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Invadolysin
Antibody
NBP1-92025
Western Blot Invadolysin Antibody
Western Blot Invadolysin Antibody
Immunohistochemistry-Paraffin Invadolysin Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
RNMT Antibody
(3H3-1D12)
H00008731-M01
Immunocytochemistry/ Immunofluorescence RNMT Antibody (3H3-1D12)
Immunohistochemistry-Paraffin RNMT Antibody (3H3-1D12)
Western Blot RNMT Antibody (3H3-1D12)
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
SLTM Antibody
NBP2-38464
Immunohistochemistry-Paraffin SLTM Antibody
Western Blot SLTM Antibody
Immunocytochemistry/ Immunofluorescence SLTM Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
IL-6 [HRP]
M6000B
N/A IL-6 [HRP]
N/A IL-6 [HRP]
N/A IL-6 [HRP]
(635 Publications)
Species: Mu
Applications: ELISA
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
TNF-alpha
[Unconjugated]
210-TA
SDS-PAGE TNF-alpha [Unconjugated]
Bioactivity TNF-alpha [Unconjugated]
SEC-MALS TNF-alpha [Unconjugated]
(3 Reviews)
(803 Publications)
Species: Hu
Applications: BA
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
PIK3CA Antibody
NBP2-19804
Western Blot PIK3CA Antibody
Immunohistochemistry-Paraffin PIK3CA Antibody
Western Blot PIK3CA Antibody
(4 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
MSPR/Ron
Recombinant Protein A
NBP1-88136PEP
MSPR/Ron Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MSPR/Ron Recombinant Protein Antigen (NBP1-88136PEP) (0)

There are no publications for MSPR/Ron Recombinant Protein Antigen (NBP1-88136PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSPR/Ron Recombinant Protein Antigen (NBP1-88136PEP) (0)

There are no reviews for MSPR/Ron Recombinant Protein Antigen (NBP1-88136PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MSPR/Ron Recombinant Protein Antigen (NBP1-88136PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MSPR/Ron Products

Research Areas for MSPR/Ron Recombinant Protein Antigen (NBP1-88136PEP)

Find related products by research area.

Blogs on MSPR/Ron

There are no specific blogs for MSPR/Ron, but you can read our latest blog posts.

Customers Who Bought This Also Bought

1 µg/lane of Recombinant Human TNF-alpha was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
TNF-alpha [Unconjugated]
210-TA-005

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MSPR/Ron Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MST1R