![Immunocytochemistry/Immunofluorescence: MOXD1 Antibody [NBP1-84233] - Staining of human cell line BJ shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MOXD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-84233-img0004.jpg "Immunocytochemistry/Immunofluorescence: MOXD1 Antibody [NBP1-84233] - Staining of human cell line BJ shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.")
| Reactivity | Hu, RtSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DINDKSITDSTVRVIWAYHHEDAGEAGPKYHDSNRGTKSLRLLNPEKTSVLSTALPYFDLVNQDVPIPNKDTTYWCQMFKIPVFQEKHHVIKVEPV |
| Predicted Species | Rat (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MOXD1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
![Simple Western CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Simple_Western_17480.jpg)
![Western Blot CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/CD117_AF1356_Western_Blot_18637.jpg)
![Immunohistochemistry CD117/c-kit Antibody [Unconjugated]](https://images.novusbio.com/images2/SCF_R_AF1356_Immunohistochemistry_9746.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MOXD1 |
![Immunohistochemistry-Paraffin: MOXD1 Antibody [NBP1-84233] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/MOXD1-Antibody-Immunohistochemistry-Paraffin-NBP1-84233-img0009.jpg "Immunohistochemistry-Paraffin: MOXD1 Antibody [NBP1-84233] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: MOXD1 Antibody [NBP1-84233] - Staining of human pancreas shows strong positivity in endoplasmic reticulum in exocrine glandular cells.](http://images.novusbio.com/fullsize/MOXD1-Antibody-Immunohistochemistry-Paraffin-NBP1-84233-img0005.jpg "Immunohistochemistry-Paraffin: MOXD1 Antibody [NBP1-84233] - Staining of human pancreas shows strong positivity in endoplasmic reticulum in exocrine glandular cells.")
![Immunohistochemistry-Paraffin: MOXD1 Antibody [NBP1-84233] - Staining of human testis shows no cytoplasmic positivity in cells in seminiferous ducts as expected.](http://images.novusbio.com/fullsize/MOXD1-Antibody-Immunohistochemistry-Paraffin-NBP1-84233-img0006.jpg "Immunohistochemistry-Paraffin: MOXD1 Antibody [NBP1-84233] - Staining of human testis shows no cytoplasmic positivity in cells in seminiferous ducts as expected.")
![Immunohistochemistry-Paraffin: MOXD1 Antibody [NBP1-84233] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.](http://images.novusbio.com/fullsize/MOXD1-Antibody-Immunohistochemistry-Paraffin-NBP1-84233-img0007.jpg "Immunohistochemistry-Paraffin: MOXD1 Antibody [NBP1-84233] - Staining of human prostate shows weak cytoplasmic positivity in smooth muscle cells.")
![Immunohistochemistry-Paraffin: MOXD1 Antibody [NBP1-84233] - Staining of human endometrium shows weak to moderate positivity in luminal membrane in glandular cells.](http://images.novusbio.com/fullsize/MOXD1-Antibody-Immunohistochemistry-Paraffin-NBP1-84233-img0008.jpg "Immunohistochemistry-Paraffin: MOXD1 Antibody [NBP1-84233] - Staining of human endometrium shows weak to moderate positivity in luminal membrane in glandular cells.")
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Immunocytochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2156_human-mouse-nurr1-ngfi-b-beta-nr4a2-affinity-purified-pab-immunocytochemistry-22112021145420.jpg)
![Immunohistochemistry Nurr1/NGFI-B beta/NR4A2 Antibody [Unconjugated]](https://images.novusbio.com/images/antibody/af2156_human-mouse-nurr1-ngfi-b-beta-nr4a2-affinity-purified-pab-immunohistochemistry-10122021111228.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")