Home » MOGAT2 » MOGAT2 Proteins » MOGAT2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MOGAT2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MOGAT2 Protein (NBP1-85230PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals offers 100% Guarantee

MOGAT2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MOGAT2.

Source: E. coli

Amino Acid Sequence: VPIFSFGENDLFDQIPNSSGSWLRYIQNRLQKIMGISLPLFHGRGVFQYSFGLIPYRRPITTVVGKPIEVQKTLHPSEEEVNQLHQRYIKELCNLFEAHKLKFNIPADQHLEF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MOGAT2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85230.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MOGAT2 Recombinant Protein Antigen

  • acyl CoA:monoacylglycerol acyltransferase 2
  • Acyl-CoA:monoacylglycerol acyltransferase 2
  • DC5
  • DGAT2L5
  • DGAT2L5MGC119183
  • Diacylglycerol acyltransferase 2-like protein 5
  • Diacylglycerol O-acyltransferase candidate 5
  • EC 2.3.1
  • EC 2.3.1.22
  • FLJ22644
  • hDC5
  • hMGAT2
  • MGAT2
  • MGAT2MGC119184
  • MGC119185
  • MOGAT2
  • monoacylglycerol O-acyltransferase 22-acylglycerol O-acyltransferase 2

Background

Dietary fat absorption from the small intestine is facilitated by acyl-CoA:monoacylglycerol transferase (MOGAT; EC 2.3.1.22) and acyl-CoA:diacylglycerol acyltransferase (DGAT; see MIM 604900) activities. MOGAT catalyzes the joining of monoacylglycerol and fatty acyl-CoAs to form diacylglycerol (Yen and Farese, 2003 [PubMed 12621063]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MGAT1
[Unconjugated]
8334-GT
MGAT1 [Unconjugated]
(3 Publications)
Species: Hu
Applications: EnzAct
MOGAT1 Antibody
NBP1-59769
Western Blot MOGAT1 Antibody
Western Blot MOGAT1 Antibody
Species: Hu
Applications: WB
DGAT1 Antibody -
BSA Free
NB110-41487
Immunocytochemistry/ Immunofluorescence DGAT1 Antibody - BSA Free
Western Blot DGAT1 Antibody - BSA Free
Western Blot DGAT1 Antibody - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, WB
SOX2 Antibody
[Unconjugated]
AF2018
Western Blot SOX2 Antibody [Unconjugated]
Chromatin Immunoprecipitation (ChIP) SOX2 Antibody [Unconjugated]
Simple Western SOX2 Antibody [Unconjugated]
(6 Reviews)
(376 Publications)
Species: Hu, Mu, Rt
Applications: ChIP, ICC, IHC, Simple Western, WB
MOGAT3 Antibody
(3F7)
H00346606-M05
Immunocytochemistry/ Immunofluorescence MOGAT3 Antibody (3F7)
Species: Hu
Applications: ELISA, ICC/IF, WB
DGAT2 Antibody -
BSA Free
NBP1-71701
Western Blot DGAT2 Antibody - BSA Free
(9 Publications)
Species: Hu, Mu, Rt
Applications: WB

N-Acetylglucosaminyltr ...
7359-GT
N-Acetylglucosaminyltransferase III/MGAT3 [Unconjugated]
(1 Publication)
Species: Hu
Applications: EnzAct
Dystroglycan
Antibody [Unconjugate
AF6868
Immunohistochemistry Dystroglycan Antibody [Unconjugated]
Western Blot Dystroglycan Antibody [Unconjugated]
Knockout Validated Dystroglycan Antibody [Unconjugated]
(23 Publications)
Species: Hu
Applications: IHC, KO, WB
Pax6 Antibody
[Unconjugated]
AF8150
Simple Western Pax6 Antibody [Unconjugated]
Immunocytochemistry Pax6 Antibody [Unconjugated]
Western Blot Pax6 Antibody [Unconjugated]
(16 Publications)
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
SLC6A12 Antibody
NBP1-88641
Immunocytochemistry/ Immunofluorescence SLC6A12 Antibody
Immunocytochemistry/ Immunofluorescence SLC6A12 Antibody
Western Blot SLC6A12 Antibody
(3 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
GAT-1/SLC6A1
Antibody
NBP3-13166
Western Blot GAT-1/SLC6A1 Antibody
Immunohistochemistry-Paraffin GAT-1/SLC6A1 Antibody
Immunohistochemistry-Paraffin GAT-1/SLC6A1 Antibody
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
SOX1 Antibody
[Unconjugated]
AF3369
Western Blot SOX1 Antibody [Unconjugated]
Simple Western SOX1 Antibody [Unconjugated]
Immunocytochemistry SOX1 Antibody [Unconjugated]
(141 Publications)
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
SOX3 Antibody
[Unconjugated]
AF2569
Immunocytochemistry SOX3 Antibody [Unconjugated]
Immunocytochemistry SOX3 Antibody [Unconjugated]
Western Blot SOX3 Antibody [Unconjugated]
(13 Publications)
Species: Hu
Applications: ICC, WB
GABA Transporter 2
Antibody
NB100-1872
Western Blot GABA Transporter 2 Antibody
Western Blot GABA Transporter 2 Antibody
Western Blot GABA Transporter 2 Antibody
(2 Publications)
Species: Hu, Mu, Rt
Applications: ELISA, Flow, WB
GIP Antibody
(911205) [Unconjugate
MAB8864
Immunohistochemistry GIP Antibody (911205) [Unconjugated]
(1 Publication)
Species: Hu
Applications: IHC
Glutaminyl-peptide
Cyclotransferase/QPCT ...
NBP1-81838
Western Blot Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry Glutaminyl-peptide Cyclotransferase/QPCT Antibody
Immunohistochemistry-Paraffin Glutaminyl-peptide Cyclotransferase/QPCT Antibody
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
MOGAT2 Recombinant
Protein Antigen
NBP1-85230PEP
MOGAT2 Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for MOGAT2 Protein (NBP1-85230PEP) (0)

There are no publications for MOGAT2 Protein (NBP1-85230PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOGAT2 Protein (NBP1-85230PEP) (0)

There are no reviews for MOGAT2 Protein (NBP1-85230PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MOGAT2 Protein (NBP1-85230PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MOGAT2 Products

Blogs on MOGAT2

There are no specific blogs for MOGAT2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western blot shows lysates of D3 mouse embryonic stem cell line, NTera-2 human testicular embryonic carcinoma cell line, F9 mouse teratocarcinoma stem cells, and rat cortical stem cells. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat SOX2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2018) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (HAF017). A specific band was detected for SOX2 at approximately 36 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
SOX2 Antibody [Unconjugated]
AF2018

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MOGAT2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MOGAT2