Reactivity | HuSpecies Glossary |
Applications | WB |
Clonality | Polyclonal |
Host | Mouse |
Conjugate | Unconjugated |
Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
Immunogen | MLX (NP_937848.1, 1 a.a. - 214 a.a.) full-length human protein. MTEPGASPEDPWVKVEYAYSDNSLDPDDEDSDYHQEAYKESYKDRRRRAHTQAEQKRRDAIKRGYDDLQTIVPTCQQQDFSIGSQKLSKAIVLQKTIDYIQFLHKEKKKQEEEVSTLRKDVTALKIMKVNYEQIVKAHQDNPHEGEDQVSDQVKFNVFQGIMDSLFQSFNASISVASFQELSACVFSWIEEHCKPQTLREIVIGVLHQLKNQLY |
Specificity | MLX - MAX-like protein X, |
Isotype | IgG |
Clonality | Polyclonal |
Host | Mouse |
Gene | MLX |
Purity | Protein A purified |
Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
Dilutions |
|
Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer | PBS (pH 7.4) |
Preservative | No Preservative |
Purity | Protein A purified |
Secondary Antibodies |
Isotype Controls |
ChREBP, a glucose sensitive transcription factor with role in glucose-lipids homeostasis and cancer ChREBP (carbohydrate response element-binding protein) is a glucose responsive basic helix-loop-helix/leucine zipper (bHLH/LZ) transcription factor that binds MLX and then carbohydrate response element /ChoRE for the induction of genes involved in ... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
Gene Symbol | MLX |
Entrez |
|
Uniprot |
|