![Western Blot: Mitofilin Antibody [NBP2-38286] - Analysis using Anti-IMMT antibody NBP2-38286 (A) shows similar pattern to independent antibody NBP2-38285 (B).](http://images.novusbio.com/fullsize/Mitofilin-Antibody-Western-Blot-NBP2-38286-img0008.jpg "Western Blot: Mitofilin Antibody [NBP2-38286] - Analysis using Anti-IMMT antibody NBP2-38286 (A) shows similar pattern to independent antibody NBP2-38285 (B).")
| Reactivity | Hu, MuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: SSGLTTGKIAGAGLLFVGGGIGGTILYAKWDSHFRESVEKTIPYSDKLFEMVLGPAAYNVPLPKKSIQSGPLKISSVSEVMKESKQ |
| Predicted Species | Mouse (90%). Backed by our 100% Guarantee. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IMMT |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Simple Western Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Simple_Western_21888.jpg)
![Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunocytochemistry__Immunofluorescence_17777.jpg)
![Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum](https://images.novusbio.com/images2/Albumin_MAB1455_Immunohistochemistry_23317.jpg)
![Myoglobin Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Myoglobin Antibody [Unconjugated]")
Secondary Antibodies |
Isotype Controls |
Research Areas for Mitofilin Antibody (NBP2-38286)Find related products by research area.
|
|
Mitofilin and the Mitochondrial Inner Membrane Organizing System (MINOS) Mitofilin was originally described as a heart muscle protein due to its high expression in the heart. Recently, analysis of the human heart mitochondrial proteome demonstrated that Mitofilin is one of the most abundant mitochondrial proteins (1). Rese... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunocytochemistry/Immunofluorescence: Mitofilin Antibody [NBP2-38286] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/Mitofilin-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-38286-img0004.jpg "Immunocytochemistry/Immunofluorescence: Mitofilin Antibody [NBP2-38286] - Staining of human cell line MCF7 shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38286] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.](http://images.novusbio.com/fullsize/Mitofilin-Antibody-Immunohistochemistry-Paraffin-NBP2-38286-img0012.jpg "Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38286] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.")
![Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38286] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.](http://images.novusbio.com/fullsize/Mitofilin-Antibody-Immunohistochemistry-Paraffin-NBP2-38286-img0009.jpg "Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38286] - Staining of human heart muscle shows moderate granular cytoplasmic positivity in cardiomyocytes.")
![Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38286] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/Mitofilin-Antibody-Immunohistochemistry-Paraffin-NBP2-38286-img0010.jpg "Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38286] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38286] - Staining of human stomach shows strong grtanular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/Mitofilin-Antibody-Immunohistochemistry-Paraffin-NBP2-38286-img0011.jpg "Immunohistochemistry-Paraffin: Mitofilin Antibody [NBP2-38286] - Staining of human stomach shows strong grtanular cytoplasmic positivity in glandular cells.")
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/BRCA2_MAB2476_Western_Blot_6033.jpg)
![Immunohistochemistry BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images2/mab2476_human-brca2-mab-clone-234403-immunohistochemistry-10520211657.jpg)
![Western Blot BRCA2 Antibody (234403) [Unconjugated]](https://images.novusbio.com/images/mab2476_human-brca2-mab-clone-234403-2282024172111.jpg)
![Western Blot Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Western_Blot_5287.jpg)
![Simple Western Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Simple_Western_16990.jpg)
![Knockout Validated Catalase Antibody [Unconjugated]](https://images.novusbio.com/images2/Catalase_AF3398_Knockout_Validated_24032.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")