![Western Blot: CHCHD3 Antibody [NBP1-83656] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.](http://images.novusbio.com/fullsize/CHCHD3-Antibody-Western-Blot-NBP1-83656-img0016.jpg "Western Blot: CHCHD3 Antibody [NBP1-83656] - Analysis in U-87MG ATCC cells transfected with control siRNA, target specific siRNA probe #1 and #2,. Remaining relative intensity is presented. Loading control: Anti-GAPDH.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, ICC/IF, IHC, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: DENENITVVKGIRLSENVIDRMKESSPSGSKSQRYSGAYGASVSDEELKRRVAEELALEQAKKESEDQKRLKQAK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | CHCHD3 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization, Use PFA/Triton X-100. |
||
| Control Peptide |
|
||
| Reviewed Applications |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Images | Ratings | Applications | Species | Date | Details | ||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
Enlarge |
reviewed by:
Kathleen Emanuel |
WB | Human | 06/15/2016 |
Summary
|
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | CHCHD3 |
![Immunocytochemistry/Immunofluorescence: CHCHD3 Antibody [NBP1-83656] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/CHCHD3-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83656-img0011.jpg "Immunocytochemistry/Immunofluorescence: CHCHD3 Antibody [NBP1-83656] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human skeletal muscle shows strong granular cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/CHCHD3-Antibody-Immunohistochemistry-Paraffin-NBP1-83656-img0015.jpg "Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human skeletal muscle shows strong granular cytoplasmic positivity in myocytes.")
![Western Blot: CHCHD3 Antibody [NBP1-83656] - Analysis in human cell line HEK 293.](http://images.novusbio.com/fullsize/CHCHD3-Antibody-Western-Blot-NBP1-83656-img0009.jpg "Western Blot: CHCHD3 Antibody [NBP1-83656] - Analysis in human cell line HEK 293.")
![Western Blot: CHCHD3 Antibody [NBP1-83656] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize/CHCHD3-Antibody-Western-Blot-NBP1-83656-img0010.jpg "Western Blot: CHCHD3 Antibody [NBP1-83656] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.")
![Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/CHCHD3-Antibody-Immunohistochemistry-Paraffin-NBP1-83656-img0012.jpg "Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/CHCHD3-Antibody-Immunohistochemistry-Paraffin-NBP1-83656-img0013.jpg "Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/CHCHD3-Antibody-Immunohistochemistry-Paraffin-NBP1-83656-img0014.jpg "Immunohistochemistry-Paraffin: CHCHD3 Antibody [NBP1-83656] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.")
![Bioactivity BMP-2 [Unconjugated]](https://images.novusbio.com/images/protein/355-bm_recombinant-human-mouse-rat-bmp-2-protein-bioactivity-181120209742.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")
