Home » Mena » Mena Peptides and Proteins » Recombinant Human Mena GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human Mena GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related Mena Peptides and Proteins

Order Details


    • Catalog Number
      H00055740-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Mena GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 291-390 of Human Mena

Source: Wheat Germ (in vitro)

Amino Acid Sequence: LQAASQPAETPSQQGIVLGPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPPPPPPAPPLPASGFFLASMSEDNRPLT
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ENAH
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Mena GST (N-Term) Protein

  • ENA
  • enabled homolog (Drosophila)
  • ENAH
  • FLJ10773
  • Mena
  • MENANDPP1
  • NDPP1
  • protein enabled homolog

Background

ENAH/MENA belongs to the Ena/vasodilator-stimulated phosphoprotein (VASP) family of proteins which play a role in regulating the actin cytoskeleton for the control of cell shape and movement. The Ena/VASP family of actin binding proteins includes ENAH/MENA which is the human homolog of drosophila Ena (enabled), VASP, and EVL (Ena/vasodilator-stimulated phosphoprotein-like protein). Ena/VASP proteins contain an EVH1 domain, a central proline-rich domain, and a terminal EVH2 domain. ENAH/MENA is not expressed in normal breast but has been detected and associated with breast lesions with a high risk of transformation and primary and metastatic breast cancer.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

VASP Antibody
(OTI4D6)
NBP2-00555
Flow Cytometry VASP Antibody (OTI4D6)
Flow Cytometry VASP Antibody (OTI4D6)
Western Blot VASP Antibody (OTI4D6)
(1 Publication)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Enah/Vasp-like
Antibody
NBP1-80831
Western Blot Enah/Vasp-like Antibody
Immunohistochemistry-Paraffin Enah/Vasp-like Antibody
Immunohistochemistry-Paraffin Enah/Vasp-like Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, WB
Zyxin Antibody
(2C10-4A7)
H00007791-M01
Immunocytochemistry/ Immunofluorescence Zyxin Antibody (2C10-4A7)
Immunoprecipitation Zyxin Antibody (2C10-4A7)
Western Blot Zyxin Antibody (2C10-4A7)
(7 Publications)
Species: Hu
Applications: ELISA, ICC/IF, IP, KD, WB
WASP Antibody
NB300-996
Immunohistochemistry-Paraffin WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
Immunocytochemistry/ Immunofluorescence WASP Antibody
(1 Publication)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
ACTR2 Antibody
(1B10-C4)
H00010097-M01
Western Blot ACTR2 Antibody (1B10-C4)
Immunohistochemistry-Paraffin ACTR2 Antibody (1B10-C4)
Sandwich ELISA ACTR2 Antibody (1B10-C4)
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
Calreticulin
Antibody - BSA Free
NB600-101
Knockdown Validated Calreticulin Antibody - BSA Free
Western Blot Calreticulin Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence Calreticulin Antibody - BSA Free
(28 Publications)
Species: Bv, Ha, Hu, Mu, Pm, Rt
Applications: B/N, DB, EM, Flow, ICC/IF, IHC, IHC-P, IP, KD, PA, Simple Western, WB
SSB Antibody
(OTI2C8)
NBP1-48002
Western Blot SSB Antibody (OTI2C8)
Immunohistochemistry-Paraffin SSB Antibody (OTI2C8)
Immunohistochemistry-Paraffin SSB Antibody (OTI2C8)
Species: Ca, Hu, Pm, Pm
Applications: ICC/IF, IHC, IHC-P, IP, WB
c-Abl Antibody
[Unconjugated]
AF5414
Western Blot c-Abl Antibody [Unconjugated]
Simple Western c-Abl Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: Simple Western, WB
Angiopoietin-like
Protein 2/ANGPTL2 Ant ...
AF1444
Western Blot Angiopoietin-like Protein 2/ANGPTL2 Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: IHC, WB
AICDA Antibody
NBP1-30955
Immunocytochemistry/ Immunofluorescence AICDA Antibody
Immunohistochemistry-Paraffin AICDA Antibody
Western Blot AICDA Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
LIX [Biotin]
DY443
N/A LIX [Biotin]
(28 Publications)
Species: Mu
Applications: ELISA
Vinculin Antibody
(728526) [Unconjugate ...
MAB6896
Simple Western Vinculin Antibody (728526) [Unconjugated]
Western Blot Vinculin Antibody (728526) [Unconjugated]
Immunohistochemistry Vinculin Antibody (728526) [Unconjugated]
(3 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
N-WASP Antibody
NBP1-82512
Immunocytochemistry/ Immunofluorescence N-WASP Antibody
Immunohistochemistry-Paraffin N-WASP Antibody
Immunohistochemistry-Paraffin N-WASP Antibody
(7 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
FE65 Antibody -
BSA Free
NB110-58360
Western Blot FE65 Antibody - BSA Free
Western Blot FE65 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: IP, WB
BAIAP2 Antibody
NBP1-88711
Immunocytochemistry/ Immunofluorescence BAIAP2 Antibody
Immunohistochemistry-Paraffin BAIAP2 Antibody
Immunohistochemistry-Paraffin BAIAP2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
TRIM21/SSA1
Antibody
NBP1-33548
Immunocytochemistry/ Immunofluorescence TRIM21/SSA1 Antibody
Immunohistochemistry-Paraffin TRIM21/SSA1 Antibody
Western Blot TRIM21/SSA1 Antibody
(3 Publications)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
Profilin 1
Antibody (OTI1D5)
NBP2-02577
Western Blot Profilin 1 Antibody (OTI1D5)
Western Blot Profilin 1 Antibody (OTI1D5)
Immunoprecipitation Profilin 1 Antibody (OTI1D5)
(3 Publications)
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
AKT [p Ser473]
Antibody [Unconjugate ...
AF887
Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific
(49 Publications)
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
CDC42 Antibody
(JJ086-04)
NBP2-67895
Flow Cytometry CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Immunohistochemistry-Paraffin CDC42 Antibody (JJ086-04)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
MTTP Antibody
NBP1-62489
Western Blot MTTP Antibody
Western Blot MTTP Antibody
(1 Review)
(1 Publication)
Species: Dr, Hu, Mu
Applications: WB

Publications for Mena Partial Recombinant Protein (H00055740-Q01) (0)

There are no publications for Mena Partial Recombinant Protein (H00055740-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mena Partial Recombinant Protein (H00055740-Q01) (0)

There are no reviews for Mena Partial Recombinant Protein (H00055740-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mena Partial Recombinant Protein (H00055740-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mena Products

Research Areas for Mena Partial Recombinant Protein (H00055740-Q01)

Find related products by research area.

Blogs on Mena.

Check out the latest blog posts on Mena.
Chemotherapy-induced metastasis: An unexpected foe?
By Yoskaly Lazo-Fernandez, PhD IntroductionEvidence has accumulated recently indicating that common cancer therapies might stimulate metastasis in a significant number of cancer patients1. In fact, neoadjuvant che...  Read full blog post.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Mena GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol ENAH