Home » MEF2C » MEF2C Proteins » MEF2C Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

MEF2C Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for MEF2C Recombinant Protein Antigen (NBP2-52925PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

MEF2C Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MEF2C.

Source: E. coli

Amino Acid Sequence: PPNFEMPVSIPVSSHNSLVYSNPVSSLGNPNLLPLAHPSLQRNSMSPGVTHRPPSAGNTGGLMGGDLTSGAGTSAGNGYGNPRNSPGLLVSPGNLNKNMQAKSPPPMNLGMNNRKPDLRVLIPPGSKNTMPSVNQRINN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MEF2C
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52925.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.
Theoretical MW
32 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MEF2C Recombinant Protein Antigen

  • DEL5q14.3
  • MEF2C
  • myocyte enhancer factor 2C
  • myocyte-specific enhancer factor 2C
  • polypeptide C

Background

Transcription activator which binds specifically to the MEF2 element present in the regulatory regions of many muscle-specific genes. Controls cardiac morphogenesis and myogenesis, and is also involved in vascular development. May also be involved in neurogenesis and in the development of cortical architecture . Isoform 3 and isoform 4, which lack the repressor domain, are more active than isoform 1 and isoform 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

MEF2A Antibody
(1C8)
H00004205-M15
Western Blot MEF2A Antibody (1C8)
ELISA MEF2A Antibody (1C8)
Immunocytochemistry/ Immunofluorescence MEF2A Antibody (1C8)
(1 Review)
Species: Hu
Applications: ELISA, ICC/IF, WB
NKX2.5 Antibody
[Unconjugated]
AF2444
Western Blot NKX2.5 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]
Immunocytochemistry/ Immunofluorescence NKX2.5 Antibody [Unconjugated]
(2 Reviews)
(13 Publications)
Species: Hu
Applications: IHC, WB
GATA-4 Antibody -
BSA Free
NBP2-24585
Immunohistochemistry-Paraffin GATA-4 Antibody - BSA Free
Western Blot GATA-4 Antibody - BSA Free
Immunohistochemistry-Paraffin GATA-4 Antibody - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
ERK5/BMK1 Antibody
[Unconjugated]
AF2848
Western Blot ERK5/BMK1 Antibody [Unconjugated]
Immunocytochemistry ERK5/BMK1 Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu
Applications: ICC, WB
MyoD Antibody
(5.8A) - BSA Free
NB100-56511
Immunocytochemistry/ Immunofluorescence MyoD Antibody (5.8A) - BSA Free
Immunocytochemistry/ Immunofluorescence MyoD Antibody (5.8A) - BSA Free
Western Blot MyoD Antibody (5.8A) - BSA Free
(2 Reviews)
(27 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
Myogenin Antibody
(671037)
MAB66861
Western Blot Myogenin Antibody (671037)
Immunocytochemistry Myogenin Antibody (671037)
(1 Review)
(3 Publications)
Species: Hu
Applications: ICC, WB
MEF2D Antibody
NBP1-85788
Immunocytochemistry/ Immunofluorescence MEF2D Antibody
ELISA MEF2D Antibody
Immunohistochemistry-Paraffin MEF2D Antibody
(2 Reviews)
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Histone
Deacetylase 4/HDAC4 A ...
NBP2-22151
Immunohistochemistry Histone Deacetylase 4/HDAC4 Antibody - BSA Free
Western Blot Histone Deacetylase 4/HDAC4 Antibody - BSA Free
Western Blot Histone Deacetylase 4/HDAC4 Antibody - BSA Free
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
MEK5 Antibody
NBP1-89654
Western Blot MEK5 Antibody
Immunohistochemistry-Paraffin MEK5 Antibody
Immunohistochemistry-Paraffin MEK5 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
HDAC5 Antibody -
BSA Free
NBP2-22152
Immunocytochemistry/ Immunofluorescence HDAC5 Antibody - BSA Free
Immunohistochemistry HDAC5 Antibody - BSA Free
Western Blot HDAC5 Antibody - BSA Free
(1 Review)
(5 Publications)
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, WB
HDAC9 Antibody -
BSA Free
NBP2-03993
Western Blot HDAC9 Antibody - BSA Free
(1 Review)
(1 Publication)
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
p38 alpha Antibody
[Unconjugated]
AF8691
Simple Western p38 alpha Antibody [Unconjugated]
Western Blot p38 alpha Antibody [Unconjugated]
Immunohistochemistry p38 alpha Antibody [Unconjugated]
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
GATA-4 Antibody -
BSA Free
NBP2-24585
Immunohistochemistry-Paraffin GATA-4 Antibody - BSA Free
Western Blot GATA-4 Antibody - BSA Free
Immunohistochemistry-Paraffin GATA-4 Antibody - BSA Free
(1 Review)
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
BMP-4
[Unconjugated]
314-BP
SDS-PAGE BMP-4 [Unconjugated]
Bioactivity BMP-4 [Unconjugated]
(504 Publications)
Species: Hu
Applications: BA, BA
p19ARF/CDKN2A
Antibody - BSA Free
NB200-106
Immunohistochemistry p19ARF/CDKN2A Antibody - BSA Free
Western Blot p19ARF/CDKN2A Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence p19ARF/CDKN2A Antibody - BSA Free
(1 Review)
(48 Publications)
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, WB
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MEF2B Antibody
NBP1-93440
Immunohistochemistry-Paraffin MEF2B Antibody
Immunohistochemistry-Paraffin MEF2B Antibody
Immunohistochemistry-Paraffin MEF2B Antibody
Species: Hu
Applications: IHC, IHC-P
VEGF [HRP]
DVE00
N/A VEGF [HRP]
N/A VEGF [HRP]
N/A VEGF [HRP]
(674 Publications)
Species: Hu
Applications: ELISA

Publications for MEF2C Recombinant Protein Antigen (NBP2-52925PEP) (0)

There are no publications for MEF2C Recombinant Protein Antigen (NBP2-52925PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MEF2C Recombinant Protein Antigen (NBP2-52925PEP) (0)

There are no reviews for MEF2C Recombinant Protein Antigen (NBP2-52925PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MEF2C Recombinant Protein Antigen (NBP2-52925PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MEF2C Products

Research Areas for MEF2C Recombinant Protein Antigen (NBP2-52925PEP)

Find related products by research area.

Blogs on MEF2C

There are no specific blogs for MEF2C, but you can read our latest blog posts.

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MEF2C Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol MEF2C