Home » MARCH8 » MARCH8 Proteins » Recombinant Human MARCH8 GST (N-Term) Protein
Novus Biologicals products are now on bio-techne.com

Recombinant Human MARCH8 GST (N-Term) Protein

 Submit a Review

Images

 
(
Enlarge)
12.5% SDS-PAGE Stained with Coomassie Blue.
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Product Discontinued
View other related MARCH8 Peptides and Proteins

Order Details


    • Catalog Number
      H00220972-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human MARCH8 GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 77-153 of Human MARCH8

Source: Wheat Germ (in vitro)

Amino Acid Sequence: QDICRICHCEGDDESPLITPCHCTGSLHFVHQACLQQWIKSSDTRCCELCKYEFIMETKLKPLRKWEKLQMTSSERR
Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
MARCHF8
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
34.21 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MARCH8 GST (N-Term) Protein

  • Cellular modulator of immune recognition
  • c-MIR
  • EC 6.3.2
  • EC 6.3.2.-
  • MARCH8
  • MARCH-VIII
  • MARCH-VIIIcellular modulator of immune recognition
  • membrane-associated ring finger (C3HC4) 8
  • Membrane-associated RING finger protein 8
  • Membrane-associated RING-CH protein VIII
  • MIR
  • RING finger protein 178
  • RNF178

Background

MARCH8 - membrane-associated ring finger (C3HC4) 8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NOC2L Antibody
NBP1-92190
Immunocytochemistry/ Immunofluorescence NOC2L Antibody
Western Blot NOC2L Antibody
Immunohistochemistry-Paraffin NOC2L Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, Simple Western, WB
AMPD1 Antibody
NBP2-24509
Western Blot AMPD1 Antibody
Immunohistochemistry-Paraffin AMPD1 Antibody
(3 Publications)
Species: Bv, Ca, Hu, Mu, Ma-Op, Pm, Rt
Applications: IHC, IHC-P, WB
Mad Antibody
NBP2-85249
Western Blot Mad Antibody
Western Blot Mad Antibody
Western Blot Mad Antibody
Species: Hu, Mu
Applications: WB
Cathepsin C/DPPI
Antibody [Unconjugate ...
AF1034
Western Blot Cathepsin C/DPPI Antibody [Unconjugated]
Immunohistochemistry Cathepsin C/DPPI Antibody [Unconjugated]
Western Blot Cathepsin C/DPPI Antibody [Unconjugated]
(13 Publications)
Species: Mu, Rt
Applications: IHC, Simple Western, WB
ATR Antibody (2B5)
NB100-308
Immunocytochemistry/ Immunofluorescence ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
Western Blot ATR Antibody (2B5)
(21 Publications)
Species: Hu, Mu
Applications: Func, ICC/IF, IP, In vitro, KO, WB
MMAB Antibody
(OTI2G5)
NBP2-03417
Flow Cytometry MMAB Antibody (OTI2G5)
Flow Cytometry MMAB Antibody (OTI2G5)
Western Blot MMAB Antibody (OTI2G5)
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
TEM8/ANTXR1
Antibody (200C1339(SB ...
NB100-56585
Immunohistochemistry-Paraffin TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
Immunohistochemistry-Paraffin TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
Western Blot TEM8/ANTXR1 Antibody (200C1339(SB20)) - BSA Free
(5 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Methionyl tRNA
synthetase Antibody
NBP1-87730
Immunocytochemistry/ Immunofluorescence Methionyl tRNA synthetase Antibody
Western Blot Methionyl tRNA synthetase Antibody
Immunohistochemistry-Paraffin Methionyl tRNA synthetase Antibody
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
SLA2 Antibody
(OTI3A7) - Azide and ...
NBP2-74210
Western Blot SLA2 Antibody (OTI3A7) - Azide and BSA Free
Flow Cytometry SLA2 Antibody (OTI3A7) - Azide and BSA Free
Immunohistochemistry SLA2 Antibody (OTI3A7) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IHC-P, WB
LIGHT/TNFSF14
[Unconjugated]
664-LI
SDS-PAGE LIGHT/TNFSF14 [Unconjugated]
Bioactivity LIGHT/TNFSF14 [Unconjugated]
(21 Publications)
Species: Hu
Applications: BA
Exosome component
10 Antibody
NBP1-32870
Western Blot Exosome component 10 Antibody
Immunohistochemistry-Paraffin Exosome component 10 Antibody
Western Blot Exosome component 10 Antibody
(2 Reviews)
(3 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, KD, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
SLC26A4 Antibody
NBP1-85237
Immunohistochemistry-Paraffin SLC26A4 Antibody
Immunohistochemistry-Frozen SLC26A4 Antibody
Immunohistochemistry-Paraffin SLC26A4 Antibody
(1 Review)
(2 Publications)
Species: Hu
Applications: IHC, IHC-Fr, IHC-P
Titin Antibody
NBP1-88071
Immunohistochemistry-Paraffin Titin Antibody
Immunohistochemistry-Paraffin Titin Antibody
Immunohistochemistry-Paraffin Titin Antibody
(4 Publications)
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
MYLIP Antibody
(OTI3A2)
NBP2-46069
Western Blot MYLIP Antibody (OTI3A2)
(1 Publication)
Species: Hu, Mu, Rt
Applications: WB
BMP-1/PCP Antibody
[Unconjugated]
AF1927
Western Blot BMP-1/PCP Antibody [Unconjugated]
Western Blot BMP-1/PCP Antibody [Unconjugated]
(10 Publications)
Species: Hu
Applications: IP, WB
B7-2/CD86 Antibody
(BU63)
NBP2-25208
Knockout Validated B7-2/CD86 Antibody (BU63)
Immunocytochemistry/ Immunofluorescence B7-2/CD86 Antibody (BU63)
Flow Cytometry B7-2/CD86 Antibody (BU63)
(27 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB
EVA1/MPZL2 Antibody
NBP2-31836
Immunohistochemistry EVA1/MPZL2 Antibody
Immunohistochemistry EVA1/MPZL2 Antibody
Immunohistochemistry EVA1/MPZL2 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for MARCH8 Partial Recombinant Protein (H00220972-Q01) (0)

There are no publications for MARCH8 Partial Recombinant Protein (H00220972-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MARCH8 Partial Recombinant Protein (H00220972-Q01) (0)

There are no reviews for MARCH8 Partial Recombinant Protein (H00220972-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MARCH8 Partial Recombinant Protein (H00220972-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MARCH8 Products

Research Areas for MARCH8 Partial Recombinant Protein (H00220972-Q01)

Find related products by research area.

Blogs on MARCH8

There are no specific blogs for MARCH8, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MARCH8 GST (N-Term) Protein and receive a gift card or discount.


Bioinformatics

Gene Symbol MARCHF8