![Immunocytochemistry/Immunofluorescence: KLF6 Antibody [NBP2-57355] - Staining of human cell line SK-MEL-30 shows localization to nucleus, nucleoli & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/KLF6-Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57355-img0001.jpg "Immunocytochemistry/Immunofluorescence: KLF6 Antibody [NBP2-57355] - Staining of human cell line SK-MEL-30 shows localization to nucleus, nucleoli & cytosol. Antibody staining is shown in green.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: SSPELSREPSQLWGCVPGELPSPGKVRSGTSGKPGDKGNGDASPDGRRRVHRCHFN |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | KLF6 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for KLF6 Antibody (NBP2-57355)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | KLF6 |
![Immunohistochemistry-Paraffin: KLF6 Antibody [NBP2-57355] - Staining of human gallbladder shows strong nuclear positivity in glandular cells.](http://images.novusbio.com/fullsize/KLF6-Antibody-Immunohistochemistry-Paraffin-NBP2-57355-img0002.jpg "Immunohistochemistry-Paraffin: KLF6 Antibody [NBP2-57355] - Staining of human gallbladder shows strong nuclear positivity in glandular cells.")
![Western Blot PACAP/ADCYAP1 Antibody [Unconjugated]](https://images.novusbio.com/images2/PACAP_AF6380_Western_Blot_10225.jpg)
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/DATA_PSG1_DPSG10_ELISA_797.jpg)
![N/A PSG1 [HRP]](https://images.novusbio.com/images2/PSG-1_DPSG10_ELISA_164.jpg)
![SDS-PAGE TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNF-alpha_210-TA_256.jpg)
![Bioactivity TNF-alpha [Unconjugated]](https://images.novusbio.com/images2/TNFalpha_210TA_1658.jpg)
![SEC-MALS TNF-alpha [Unconjugated]](https://images.novusbio.com/images/210-ta_recombinant-human-tnf-alpha-protein-sec-mals-35202312244..jpg)
![Western Blot PERK Antibody [Unconjugated]](https://images.novusbio.com/images2/PERK_AF3999_Western_Blot_5379.jpg)
![Knockout Validated PERK Antibody [Unconjugated]](https://images.novusbio.com/images2/PERK_AF3999_Knockout_Validated_22482.jpg)
![Western Blot PERK Antibody [Unconjugated]](https://images.novusbio.com/images/af3999_human-perk-affinity-purified-polyclonal-ab-4120241240258.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")