Home » KA2/GRIK5/Glutamate Receptor KA2 » KA2/GRIK5/Glutamate Receptor KA2 Proteins » KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human KA2/GRIK5/Glutamate Receptor KA2.

Source: E. coli

Amino Acid Sequence: KVSTIIIDANASISHLILRKASELGMTSAFYKYILTTMDFPILHLDGIVEDSSNILGFSMFNTSHPFYPEFVRSLNMSWRENCEASTY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GRIK5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-68975.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen

  • EAA2
  • Excitatory amino acid receptor 2
  • GluK5
  • glutamate receptor KA2
  • Glutamate receptor KA-2
  • glutamate receptor, ionotropic kainate 5
  • glutamate receptor, ionotropic, kainate 5
  • GRIK2
  • GRIK5
  • KA2/GRIK5
  • KA2GRIK2

Background

Glutamate receptor KA2 is a protein that interacts with glutamate, an excitatory neurotransmitter, in the central nervous system and that has two isoforms, measuring 980 and 981 amino acids in length, with weights of approximately 109 and 110 kDa respectively. Current studies are being done on diseases and disorders related to this protein including temporal lobe epilepsy, embryonal carcinoma, Parkinson's disease, schizophrenia, retinoblastoma, neruoblastoma, thyroiditis, and neuronitis. Glutamate receptor KA2 has also been shown to have interactions with GOLM1, GPAA1, LRSAM1, DLG4, and GRID2 in pathways such as the glutamic acid signaling, transmission across chemical synapses, and activation of kainite receptor pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...


KA1/GRIK4/Glutamate Re ...
NBP1-76851
Immunohistochemistry KA1/GRIK4/Glutamate Receptor KA1 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence KA1/GRIK4/Glutamate Receptor KA1 Antibody - BSA Free
Western Blot KA1/GRIK4/Glutamate Receptor KA1 Antibody - BSA Free
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
GluR5/GRIK1
Antibody - BSA Free
NBP1-76849
Immunocytochemistry/ Immunofluorescence GluR5/GRIK1 Antibody - BSA Free
Immunohistochemistry GluR5/GRIK1 Antibody - BSA Free
Immunohistochemistry GluR5/GRIK1 Antibody - BSA Free
(1 Publication)
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
GluR2 Antibody
(JU20-43)
NBP2-75510
Immunocytochemistry/ Immunofluorescence GluR2 Antibody (JU20-43)
Immunocytochemistry/ Immunofluorescence GluR2 Antibody (JU20-43)
Immunohistochemistry-Paraffin GluR2 Antibody (JU20-43)
(2 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
mGluR2 Antibody -
BSA Free
NLS892
Immunohistochemistry-Paraffin mGluR2 Antibody - BSA Free
Immunocytochemistry/ Immunofluorescence mGluR2 Antibody - BSA Free
Immunohistochemistry-Paraffin mGluR2 Antibody - BSA Free
Species: Bt, Bv, Ca, Ha, Hu, Mu, Po, Rb, Rt
Applications: ICC, IHC, IHC-P, WB
GluR1 Antibody
(S355-1)
NBP2-22399
Western Blot GluR1 Antibody (S355-1)
Immunocytochemistry/ Immunofluorescence GluR1 Antibody (S355-1)
Immunocytochemistry/ Immunofluorescence GluR1 Antibody (S355-1)
(4 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
GluR7/GRIK3
Antibody (2B3D1) - BS
NBP2-61782
ELISA GluR7/GRIK3 Antibody (2B3D1) - BSA Free
Immunocytochemistry/ Immunofluorescence GluR7/GRIK3 Antibody (2B3D1) - BSA Free
Immunocytochemistry/ Immunofluorescence GluR7/GRIK3 Antibody (2B3D1) - BSA Free
Species: Hu
Applications: ELISA, ICC/IF, WB
NMDAR1 Antibody
(R1JHL) - Azide and B ...
NB300-118
Western Blot NMDAR1 Antibody (R1JHL) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence NMDAR1 Antibody (R1JHL) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence NMDAR1 Antibody (R1JHL) - Azide and BSA Free
(14 Reviews)
(21 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
mGluR7 Antibody -
BSA Free
NLS921
Immunohistochemistry-Paraffin mGluR7 Antibody - BSA Free
Immunohistochemistry-Paraffin mGluR7 Antibody - BSA Free
Immunohistochemistry-Paraffin mGluR7 Antibody - BSA Free
Species: Bv, Hu
Applications: ICC, IHC, IHC-P, WB
Glutamate Receptor
4 Antibody
NBP1-02312
Western Blot Glutamate Receptor 4 Antibody
Immunohistochemistry-Paraffin Glutamate Receptor 4 Antibody
(1 Publication)
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Glutamate Receptor
3 Antibody
NBP3-17081
Immunohistochemistry-Paraffin Glutamate Receptor 3 Antibody
Immunohistochemistry-Paraffin Glutamate Receptor 3 Antibody
Immunohistochemistry-Paraffin Glutamate Receptor 3 Antibody
Species: Hu
Applications: IHC, IHC-P
NDOR1 Antibody
NBP1-88790
Immunocytochemistry/ Immunofluorescence NDOR1 Antibody
Immunohistochemistry-Paraffin NDOR1 Antibody
Immunohistochemistry-Paraffin NDOR1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NMDAR2B Antibody
NB300-106
Western Blot NMDAR2B Antibody
Flow Cytometry NMDAR2B Antibody
Western Blot NMDAR2B Antibody
(3 Reviews)
(19 Publications)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IP, WB
mGluR3 Antibody -
BSA Free
NLS3208
Immunohistochemistry-Paraffin mGluR3 Antibody - BSA Free
Immunohistochemistry-Paraffin mGluR3 Antibody - BSA Free
Immunohistochemistry-Paraffin mGluR3 Antibody - BSA Free
Species: Bv, Eq, Hu, Pm, Po, Pm
Applications: ICC, IHC, IHC-P, WB
NMDAR2A Antibody
NB300-105
Western Blot NMDAR2A Antibody
Western Blot NMDAR2A Antibody
Western Blot NMDAR2A Antibody
(17 Publications)
Species: Hu, Mu, Rb, Rt
Applications: IHC, IHC-P, IP, KO, WB
Glutathione
Reductase Antibody
NBP2-16684
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
Western Blot Glutathione Reductase Antibody
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
HSD17B12 Antibody
(4G11)
H00051144-M08
Sandwich ELISA HSD17B12 Antibody (4G11)
Western Blot HSD17B12 Antibody (4G11)
Western Blot HSD17B12 Antibody (4G11)
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
mGluR5/1 Antibody
NB300-126
Western Blot mGluR5/1 Antibody
(1 Review)
(4 Publications)
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
Carbonic Anhydrase
III/CA3 Antibody (4A1 ...
H00000761-M02
Western Blot Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)
Immunohistochemistry-Paraffin Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)
Sandwich ELISA Carbonic Anhydrase III/CA3 Antibody (4A12-1A3)
(5 Publications)
Species: Hu, Mu
Applications: ELISA, Func, IHC, IHC-P, S-ELISA, WB
GAD1/GAD67
Antibody [Unconjugate
AF2086
Immunohistochemistry GAD1/GAD67 Antibody [Unconjugated]
Western Blot GAD1/GAD67 Antibody [Unconjugated]
Simple Western GAD1/GAD67 Antibody [Unconjugated]
(13 Publications)
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NMDAR2C Antibody -
Azide and BSA Free
NB300-107
Western Blot NMDAR2C Antibody - Azide and BSA Free
(5 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IP, WB

Publications for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP) (0)

There are no publications for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP) (0)

There are no reviews for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional KA2/GRIK5/Glutamate Receptor KA2 Products

Research Areas for KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen (NBP2-68975PEP)

Find related products by research area.

Blogs on KA2/GRIK5/Glutamate Receptor KA2

There are no specific blogs for KA2/GRIK5/Glutamate Receptor KA2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: NMDAR1 Antibody (R1JHL) [NB300-118] - The blots show the examples of immunobands against NMDAR1 and beta-actin antibodies on the membrane, which was performed on the membrane protein prepared from the lumbar spinal cords of the offspring (P14) rats in different groups. Image collected and cropped by CiteAb from the following publication (https://www.jbiomedsci.com/content/18/1/64) licensed under a CC-BY license.
NMDAR1 Antibody (R1JHL) - Azide and BSA Free
NB300-118
Western Blot: NMDAR2B Antibody [NB300-106] - The blots show the examples of immunobands against NMDAR2B (C) and beta-actin antibodies on the membrane, which was performed on the membrane protein prepared from the lumbar spinal cords of the offspring (P14) rats in different groups. Image collected and cropped by CiteAb from the following publication (https://www.jbiomedsci.com/content/18/1/64) licensed under a CC-BY license.
NMDAR2B Antibody
NB300-106-100ul

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our KA2/GRIK5/Glutamate Receptor KA2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GRIK5