![Immunohistochemistry-Paraffin: ITGB1BP3 Antibody [NBP2-56059] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize/ITGB1BP3-Antibody-Immunohistochemistry-Paraffin-NBP2-56059-img0001.jpg "Immunohistochemistry-Paraffin: ITGB1BP3 Antibody [NBP2-56059] - Staining of human skeletal muscle shows moderate cytoplasmic positivity in myocytes.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: VYLDGMKSREELFREVLEDIQNSLLNRSQESAPSPARPARTQGPGRGCGHRTARPAASQQDSM |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | NMRK2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
| Publication using NBP2-56059 | Applications | Species |
|---|---|---|
| Chen Y, Yang L, Lu Y et al. Up-regulation of NMRK2 mediated by TFE3 fusions is the key for energy metabolism adaption of Xp11.2 translocation renal cell carcinoma Cancer letters 2022-04-18 [PMID: 35447281] (IHC-P, Human) | IHC-P | Human |
Secondary Antibodies |
Isotype Controls |
Research Areas for ITGB1BP3 Antibody (NBP2-56059)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | NMRK2 |
![Immunocytochemistry Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Immunocytochemistry_10249.jpg)
![Western Blot Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Western_Blot_5429.jpg)
![Simple Western Paxillin Antibody [Unconjugated]](https://images.novusbio.com/images2/Paxillin_AF4259_Simple_Western_17510.jpg)
![Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Flow_Cytometry_17077.jpg)
![Immunocytochemistry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Immunocytochemistry__Immunofluorescence_17398.jpg)
![Flow Cytometry Integrin beta 1/CD29 Antibody (P5D2) [Unconjugated]](https://images.novusbio.com/images2/Integrin_beta_1_MAB17781_Flow_Cytometry_23861.jpg)
![SDS-PAGE GDF-8/Myostatin [Unconjugated]](https://images.novusbio.com/images2/GDF-8_788-G8_CF_114.jpg)
![Bioactivity GDF-8/Myostatin [Unconjugated]](https://images.novusbio.com/images2/GDF-8_788-G8_CF_116.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_871.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/DATA_VEGF_DVE00_ELISA_872.jpg)
![N/A VEGF [HRP]](https://images.novusbio.com/images2/VEGF_DVE00_ELISA_208.jpg)
![Simple Western ECM-1/Secretory Component P85 Antibody [Unconjugated]](https://images.novusbio.com/images2/ECM1_AF3937_Simple_Western_20721.jpg)
![Immunohistochemistry ECM-1/Secretory Component P85 Antibody [Unconjugated]](https://images.novusbio.com/images2/ECM-1_AF3937_Immunohistochemistry_6814.jpg)
![Western Blot ECM-1/Secretory Component P85 Antibody [Unconjugated]](https://images.novusbio.com/images2/ECM1_AF3937_Western_Blot_20243.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")