Home » ISCU » ISCU Proteins » ISCU Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

ISCU Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for ISCU Protein (NBP2-38829PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

ISCU Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ISCU.

Source: E. coli

Amino Acid Sequence: PARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFK

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ISCU
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38829.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ISCU Recombinant Protein Antigen

  • 2310020H20Rik
  • HML
  • hnifU
  • iron-sulfur cluster assembly enzyme ISCU, mitochondrial
  • iron-sulfur cluster scaffold homolog (E. coli)
  • IscU iron-sulfur cluster scaffold homolog (E. coli)
  • IscU iron-sulfur cluster scaffold homolog
  • IscU
  • ISU2
  • MGC74517
  • NIFU
  • NifU-like N-terminal domain containing
  • NifU-like N-terminal domain-containing protein
  • NifU-like protein
  • NIFUN

Background

Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NGFI-B
alpha/Nur77/NR4A1 Ant
NB100-56745
Western Blot NGFI-B alpha/Nur77/NR4A1 Antibody
Unknown NGFI-B alpha/Nur77/NR4A1 Antibody
Immunohistochemistry-Paraffin NGFI-B alpha/Nur77/NR4A1 Antibody
(3 Reviews)
(30 Publications)
Species: Hu, Mu
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, WB
Sir2.1 Antibody
NB100-1923
Western Blot Sir2.1 Antibody
(1 Review)
(2 Publications)
Species: Ce
Applications: IHC, IHC-P, IP, WB
NFS1 Antibody
NBP2-37933
Immunohistochemistry-Paraffin NFS1 Antibody
Immunohistochemistry-Paraffin NFS1 Antibody
Immunohistochemistry-Paraffin NFS1 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P
HO-1/HMOX1/HSP32
Antibody (HO-1-1)
NBP1-97507
Flow Cytometry HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Immunohistochemistry-Paraffin HO-1/HMOX1/HSP32 Antibody (HO-1-1)
Western Blot HO-1/HMOX1/HSP32 Antibody (HO-1-1)
(1 Review)
(20 Publications)
Species: Bv, Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
S100A9 Antibody
[Unconjugated]
AF2065
Immunocytochemistry S100A9 Antibody [Unconjugated]
Immunohistochemistry S100A9 Antibody [Unconjugated]
Immunocytochemistry S100A9 Antibody [Unconjugated]
(2 Reviews)
(34 Publications)
Species: Mu
Applications: ICC, IHC, Simple Western, WB
S100A8 Antibody
[Unconjugated]
AF3059
Immunocytochemistry S100A8 Antibody [Unconjugated]
Western Blot S100A8 Antibody [Unconjugated]
Simple Western S100A8 Antibody [Unconjugated]
(2 Reviews)
(26 Publications)
Species: Mu
Applications: ICC, Simple Western, WB
TERF2IP Antibody
NB100-292
Immunohistochemistry-Paraffin TERF2IP Antibody
Immunoprecipitation TERF2IP Antibody
Western Blot TERF2IP Antibody
(22 Publications)
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
Rabex5 Antibody
NBP1-49938
Western Blot Rabex5 Antibody
Immunohistochemistry-Paraffin Rabex5 Antibody
Western Blot Rabex5 Antibody
(2 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Rap1A/B Antibody
[Unconjugated]
AF3767
Western Blot Rap1A/B Antibody [Unconjugated]
Western Blot Rap1A/B Antibody [Unconjugated]
Immunohistochemistry Rap1A/B Antibody [Unconjugated]
(4 Publications)
Species: Hu, Mu, Rt
Applications: IHC, WB
Frataxin Antibody
(OTI1C12)
NBP2-01743
Flow Cytometry Frataxin Antibody (OTI1C12)
Western Blot Frataxin Antibody (OTI1C12)
Immunohistochemistry-Paraffin Frataxin Antibody (OTI1C12)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SLURP1 Antibody
AF4479
Immunohistochemistry SLURP1 Antibody
(1 Publication)
Species: Hu
Applications: IHC
HIST1H4F
Overexpression Lysate
NBP2-07996
Western Blot HIST1H4F Overexpression Lysate
Species: Hu
Applications: WB
H4/n Antibody
(3E7H2) - BSA Free
NBP2-52486
ELISA H4/n Antibody (3E7H2) - BSA Free
Western Blot H4/n Antibody (3E7H2) - BSA Free
Flow Cytometry H4/n Antibody (3E7H2) - BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Recombinant Human
HIST1H4I GST (N-Term) ...
H00008294-P01
SDS-PAGE Recombinant Human HIST1H4I GST (N-Term) Protein
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
H4/e
Overexpression Lysate
NBL1-11570
Western Blot H4/e Overexpression Lysate
Species: Hu
Applications: WB
H4/h Antibody (6D4)
H00008365-M01
Sandwich ELISA H4/h Antibody (6D4)
Immunocytochemistry/ Immunofluorescence H4/h Antibody (6D4)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA
H4/j
Overexpression Lysate
NBL1-11567
Western Blot H4/j Overexpression Lysate
Species: Hu
Applications: WB
Histone H4 Antibody
AF5215
Western Blot Histone H4 Antibody
Immunocytochemistry Histone H4 Antibody
(6 Publications)
Species: Hu, Mu
Applications: ICC, WB

Publications for ISCU Protein (NBP2-38829PEP) (0)

There are no publications for ISCU Protein (NBP2-38829PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ISCU Protein (NBP2-38829PEP) (0)

There are no reviews for ISCU Protein (NBP2-38829PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ISCU Protein (NBP2-38829PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ISCU Products

Blogs on ISCU

There are no specific blogs for ISCU, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: NGFI-B alpha/Nur77/NR4A1 Antibody [NB100-56745] - RNA-seq results were validated by Western blot analysis in WT and calpain-1 KO mice. Western blot images and quantifications showing the expression levels of NGFI-B alpha/Nur77/NR4A1 protein in three independent replicates, respectively. Dot plots were used for the quantification of the expression levels of protein compared to actin control in WT and calpain-1 KO mice. Unpaired t-test in Prism 7 was used to calculate p values, *p < 0.05, **p < 0.01, ***p < 0.001. Image collected and cropped by CiteAb from the following publication (https://www.frontiersin.org/article/10.3389/fgene.2020.00334/full), licensed under a CC-BY license.
NGFI-B alpha/Nur77/NR4A1 Antibody
NB100-56745
S100A9 was detected in immersion fixed XB2 mouse teratoma keratinocyte cell line using 10 µg/mL Goat Anti-Mouse S100A9 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2065) for 3 hours at room temperature. Cells were stained with the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; NL001) and counte-rstained with DAPI (blue). View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
S100A9 Antibody [Unconjugated]
AF2065

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ISCU Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol ISCU