Home » IL-17RB » IL-17RB Proteins » IL-17RB Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

IL-17RB Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

IL-17RB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human IL17 RB.

Source: E. coli

Amino Acid Sequence: QCGSETGPSPEWMLQHDLIPGDLRDLRVEPVTTSVATGDYSILMNVSWVLRADASIRLLKATKICVTGKSNFQSYSCVRCNYTEAFQTQTRPSGGKWTFSYIGFPVELNTVYFIGAHNIPNANMNEDGPSMSVNFTSPG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
IL17RB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85450.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for IL-17RB Recombinant Protein Antigen

  • CRL4IL-17 receptor homolog 1
  • cytokine receptor CRL4
  • Cytokine receptor-like 4
  • Evi27
  • EVI27IL-17B receptor
  • IL-17 RB
  • IL-17 receptor B
  • IL-17 RH1
  • IL17BRinterleukin 17B receptor
  • IL-17ER
  • IL17RB
  • IL-17RB
  • IL17Rh1
  • IL-17Rh1
  • IL17RH1MGC5245
  • interleukin 17 receptor B
  • interleukin 17 receptor homolog 1
  • interleukin-17 receptor B
  • Interleukin-17B receptor

Background

IL17B Receptor is encoded by this gene is a cytokine receptor. This receptor specifically binds to IL17B and IL17E, but does not bind to IL17 and IL17C. This receptor has been shown to mediate the activation of NF-kappaB and the production of IL8 induced by IL17E. The expression of the rat counterpart of this gene was found to be significantly up-regulated during intestinal inflammation, which suggested the immunoregulatory activity of this receptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

CDT2 Antibody
NB100-40840
Immunoprecipitation CDT2 Antibody
Western Blot CDT2 Antibody
Immunohistochemistry-Paraffin CDT2 Antibody
(1 Review)
(7 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
PCNA Antibody
(PC10)
NB500-106
Immunocytochemistry/ Immunofluorescence PCNA Antibody (PC10)
Western Blot PCNA Antibody (PC10)
Flow Cytometry PCNA Antibody (PC10)
(5 Reviews)
(45 Publications)
Species: Ch, Dr, Fi, Hu, Mar, Mu, Po, Pm, Rb, Rt, Ye, Ze
Applications: ChIP, ChIP, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
IL-17RA/IL-17R
Antibody (133617) [Un ...
MAB177
Neutralization IL-17RA/IL-17R Antibody (133617) [Unconjugated]
Flow Cytometry IL-17RA/IL-17R Antibody (133617) [Unconjugated]
Knockout Validated IL-17RA/IL-17R Antibody (133617) [Unconjugated]
(20 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, KO, Neut, WB
IL-17/IL-17A
[Biotin]
DY421
N/A IL-17/IL-17A [Biotin]
(191 Publications)
Species: Mu
Applications: ELISA
HOXB13 Antibody
[Unconjugated]
AF8156
Western Blot HOXB13 Antibody [Unconjugated]
Immunocytochemistry HOXB13 Antibody [Unconjugated]
Immunohistochemistry HOXB13 Antibody [Unconjugated]
(1 Publication)
Species: Hu
Applications: ICC, IHC, WB
ZNF645 Antibody
NBP2-21037
Western Blot ZNF645 Antibody
Immunohistochemistry-Paraffin ZNF645 Antibody
Species: Hu
Applications: IHC, IHC-P, WB
MUL1 Antibody
(5H6.2D5) - BSA Free
NBP2-31361
Western Blot MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Immunohistochemistry-Paraffin MUL1 Antibody (5H6.2D5) - BSA Free
Species: Hu
Applications: IHC, IHC-P, WB
TRIM50 Antibody
NBP1-81988
Immunohistochemistry-Paraffin TRIM50 Antibody
Species: Hu
Applications: IHC, IHC-P
IL-4 [Unconjugated]
6507-IL/CF
Bioactivity IL-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
SETD8 Antibody -
BSA Free
NBP1-91269
Western Blot SETD8 Antibody - BSA Free
Western Blot SETD8 Antibody - BSA Free
(2 Reviews)
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
IL-13 [Biotin]
DY413
N/A IL-13 [Biotin]
(148 Publications)
Species: Mu
Applications: ELISA
CD4 Antibody - BSA
Free
NBP1-19371
Immunohistochemistry-Frozen CD4 Antibody - BSA Free
Immunohistochemistry-Paraffin CD4 Antibody - BSA Free
Flow Cytometry CD4 Antibody - BSA Free
(9 Reviews)
(50 Publications)
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
VprBP Antibody
NBP2-27203
Western Blot VprBP Antibody
Flow Cytometry VprBP Antibody
Species: Ch, ChHa, Eq, Fe, Gp, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt
Applications: Flow, WB
p21/CIP1/CDKN1A
Antibody (WA-1)
NBP2-29463
Immunohistochemistry-Paraffin p21/CIP1/CDKN1A Antibody (WA-1)
(24 Publications)
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
DDB1 Antibody
(JU32-35)
NBP2-75465
Immunocytochemistry/ Immunofluorescence DDB1 Antibody (JU32-35)
Immunocytochemistry/ Immunofluorescence DDB1 Antibody (JU32-35)
Immunocytochemistry/ Immunofluorescence DDB1 Antibody (JU32-35)
(3 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
CDT1 Antibody
NB100-2567
Western Blot CDT1 Antibody
Western Blot CDT1 Antibody
Immunohistochemistry-Paraffin CDT1 Antibody
(3 Reviews)
(5 Publications)
Species: Hu
Applications: IHC, IHC-P, IP, WB
BAFF/BLyS/TNFSF13B
[HRP]
DBLYS0B
N/A BAFF/BLyS/TNFSF13B [HRP]
N/A BAFF/BLyS/TNFSF13B [HRP]
(67 Publications)
Species: Hu
Applications: ELISA
IL-17RB
Recombinant Protein A
NBP1-85450PEP
IL-17RB Recombinant Protein Antigen
Species: Hu
Applications: AC

Publications for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP) (0)

There are no publications for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP) (0)

There are no reviews for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional IL-17RB Products

Research Areas for IL-17RB Recombinant Protein Antigen (NBP1-85450PEP)

Find related products by research area.

Blogs on IL-17RB

There are no specific blogs for IL-17RB, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our IL-17RB Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol IL17RB