IFITM2 Antibody (1F2) Summary
Immunogen |
IFITM2 (NP_006426.1, 1 a.a. ~ 59 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MNHIVQTFSPVNSGQPPNYEMLKEEQEVAMLGAPHNPAPPTSTVIHIRSETSVPDHVVW |
Specificity |
Reacts with interferon induced transmembrane protein 2 (1-8D). |
Isotype |
IgG2a Kappa |
Clonality |
Monoclonal |
Host |
Mouse |
Gene |
IFITM2 |
Purity |
Protein A purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- ELISA
- Sandwich ELISA
- Western Blot
|
Application Notes |
This antibody is reactive against cell lysate in western blot and recombinant protein in ELISA. |
Packaging, Storage & Formulations
Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
Buffer |
In 1x PBS, pH 7.4 |
Preservative |
No Preservative |
Purity |
Protein A purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for IFITM2 Antibody (1F2)
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Mu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow-CS, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, WB
Species: Bv, Ca, Ch, ChHa, Eq, Hu, Mu, Po, Pm, Rb, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Hu, Mu, Po, Rt
Applications: DB, ELISA, ICC/IF, IHC, IHC-P, PLA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, IP, WB
Species: Hu
Applications: WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, AP, PA, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
Species: Hu
Applications: IHC
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB, ELISA
Publications for IFITM2 Antibody (H00010581-M14) (0)
There are no publications for IFITM2 Antibody (H00010581-M14).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for IFITM2 Antibody (H00010581-M14) (0)
There are no reviews for IFITM2 Antibody (H00010581-M14).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for IFITM2 Antibody (H00010581-M14) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional IFITM2 Products
Research Areas for IFITM2 Antibody (H00010581-M14)
Find related products by research area.
|
Blogs on IFITM2