![Western Blot: IFI27 Antibody [H00003429-D01P] - Analysis of IFI27 expression in transfected 293T cell line by IFI27 polyclonal antibody.Lane 1: IFI27 transfected lysate(11.30 KDa).Lane 2: Non-transfected lysate.](http://images.novusbio.com/fullsize/IFI27-Antibody-Western-Blot-H00003429-D01P-img0002.jpg "Western Blot: IFI27 Antibody [H00003429-D01P] - Analysis of IFI27 expression in transfected 293T cell line by IFI27 polyclonal antibody.Lane 1: IFI27 transfected lysate(11.30 KDa).Lane 2: Non-transfected lysate.")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody reactive against mammalian transfected lysate. |
| Immunogen | IFI27 (NP_005523.3, 1 a.a. - 119 a.a.) full-length human protein. MEASALTSSAVTSVAKVVRVASGSAVVLPLARIATVVIGGVVAVPMVLSAMGFTAAGIASSSIAAKMMSAAAIANGGGVASGSLVATLQSLGATGLSGLTKFILGSIGSAIAAVIARFY |
| Specificity | IFI27 - interferon, alpha-inducible protein 27, |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | IFI27 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. |
|
| Publications |
|
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.4) |
| Preservative | No Preservative |
| Purity | Protein A purified |
![Western Blot PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Western_Blot_11082.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11144.jpg)
![Immunohistochemistry PAK3 Antibody [Unconjugated]](https://images.novusbio.com/images2/PAK3_AF6897_Immunohistochemistry_11480.jpg)
![Western Blot AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Western_Blot_5930.jpg)
![Simple Western AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/16332.jpg)
![Intracellular Staining by Flow Cytometry AKT [p Ser473] Antibody [Unconjugated] - Pan Specific](https://images.novusbio.com/images2/Akt3_AF887_Flow_Cytometry_8283.jpg)
| Publications using H00003429-D01P | Applications | Species |
|---|---|---|
| Hsieh WL, Huang YH, Wang TM et al. IFI27, a novel epidermal growth factor-stabilized protein, is functionally involved in proliferation and cell cycling of human epidermal keratinocytes. Cell Prolif. 2015-02-09 [PMID: 25664647] | ||
| Mclean A, Tang B, Parnell GP et al. Risk Stratification in Influenza. United States Patent Application 2015-11-12 |
Secondary Antibodies |
Isotype Controls |
Research Areas for IFI27 Antibody (H00003429-D01P)Find related products by research area.
|
|
COVID-19 and metabolic dysregulation: SARS-CoV-2 injures human exocrine and endocrine pancreas Jamshed Arslan, Pharm D, PhD Humans rely on the pancreas for digesting food and generating energy from it. SARS-CoV-2-mediated damage to the exocrine pancreas is evident from the pancreatitis, pancreatic enlargeme... Read full blog post. |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | IFI27 |
| Entrez |
|
| Uniprot |
|
![Western Blot p27/Kip1 [p Thr157] Antibody](https://images.novusbio.com/images2/p27_AF1555_Western_Blot_5119.jpg)
![Western Blot CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Western_Blot_13865.jpg)
![Immunohistochemistry CIB1 Antibody (791119) [Unconjugated]](https://images.novusbio.com/images2/CIB1_MAB7557_Immunohistochemistry_13917.jpg)
![Western Blot RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Western_Blot_10216.jpg)
![Immunocytochemistry RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Immunocytochemistry_10464.jpg)
![Simple Western RB1 Antibody (607121) [Unconjugated]](https://images.novusbio.com/images2/RB1_MAB6495_Simple_Western_16629.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")