![Sandwich ELISA: Hsp70 interacting protein HIP Antibody (2B2) [H00006767-M02] - Detection limit for recombinant GST tagged ST13 is 0.3 ng/ml as a capture antibody.](http://images.novusbio.com/fullsize/Hsp70-interacting-protein-HIP-Antibody-2B2-Sandwich-ELISA-H00006767-M02-img0001.jpg "Sandwich ELISA: Hsp70 interacting protein HIP Antibody (2B2) [H00006767-M02] - Detection limit for recombinant GST tagged ST13 is 0.3 ng/ml as a capture antibody.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ELISA |
| Clone | 2B2 |
| Clonality | Monoclonal |
| Host | Mouse |
| Conjugate | Unconjugated |
| Description | Quality control test: Antibody Reactive Against Recombinant Protein. |
| Immunogen | ST13 (AAH15317, 1 a.a. ~ 58 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MLFKSFKNTHHINLHLSLCVLLLMCRVLLSRNCQCVLGLTQEQFLLDSLFDLFNLIIF |
| Specificity | ST13 - suppression of tumorigenicity 13 (colon carcinoma) (Hsp70 interacting protein) (2B2) |
| Isotype | IgG2a Kappa |
| Clonality | Monoclonal |
| Host | Mouse |
| Gene | ST13 |
| Purity | IgG purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Application Notes | Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control. |
| Storage | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer | In 1x PBS, pH 7.4 |
| Preservative | No Preservative |
| Purity | IgG purified |
![Western Blot STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Western_Blot_5226.jpg)
![Simple Western STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/16351.jpg)
![Intracellular Staining by Flow Cytometry STAT1 [p Tyr701] Antibody [Unconjugated]](https://images.novusbio.com/images2/STAT1_AF2894_Flow_Cytometry_8189.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for Hsp70 interacting protein HIP Antibody (H00006767-M02)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Simple Western STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]](https://images.novusbio.com/images2/16353.jpg)
![Flow Cytometry STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]](https://images.novusbio.com/images2/STAT2_MAB2890_Flow_Cytometry_18682.jpg)
![Western Blot STAT2 [p Tyr690] Antibody (1021D) [Unconjugated]](https://images.novusbio.com/images2/STAT2_MAB2890_Western_Blot_14700.jpg)
