Home » HSD17B4 » HSD17B4 Proteins » HSD17B4 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

HSD17B4 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for HSD17B4 Protein (NBP1-85295PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

100% Guarantee on every product

HSD17B4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSD17B4.

Source: E. coli

Amino Acid Sequence: VNNAGILRDRSFARISDEDWDIIHRVHLRGSFQVTRAAWEHMKKQKYGRIIMTSSASGIYGNFGQANYSAAKLGLLGLANSLAIEGRKSNIHCNTIAPNAGSRMTQTVMPEDLVEALKPEYVAPLV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSD17B4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85295.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.
Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HSD17B4 Recombinant Protein Antigen

  • 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase
  • 7-alpha
  • D-bifunctional protein
  • EDH17B4
  • hydroxysteroid (17-beta) dehydrogenase 4
  • MPF-2
  • peroxisomal multifunctional enzyme type 2,17-beta-HSD IV
  • peroxisomal multifunctional protein 2,17beta-estradiol dehydrogenase type IV
  • peroxisomal
  • short chain dehydrogenase/reductase family 8C, member 1,3-alpha

Background

The protein encoded by the HSD17B4 gene is a bifunctional enzyme that is involved in the peroxisomal beta-oxidation pathwayfor fatty acids. It also acts as a catalyst for the formation of 3-ketoacyl-CoA intermediates from both straight-chainand 2-methyl-branched-chain fatty acids. Defects in this gene that affect the peroxisomal fatty acid beta-oxidationactivity are a cause of D-bifunctional protein deficiency (DBPD). An apparent pseudogene of this gene is present onchromosome 8. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

ACE/CD143 Antibody
[Unconjugated]
AF1513
Immunohistochemistry ACE/CD143 Antibody [Unconjugated]
Western Blot ACE/CD143 Antibody [Unconjugated]
Simple Western ACE/CD143 Antibody [Unconjugated]
(1 Review)
(7 Publications)
Species: Mu
Applications: CyTOF-ready, Flow, IHC, IP, Simple Western, WB
Insulin Antibody
(182410) [Unconjugate ...
MAB1417
Immunocytochemistry Insulin Antibody (182410) [Unconjugated]
Immunohistochemistry Insulin Antibody (182410) [Unconjugated]
(24 Publications)
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Albumin Antibody
(188835) [Unconjugate ...
MAB1455
Simple Western Albumin Antibody (188835) [Unconjugated] - Serum
Immunocytochemistry Albumin Antibody (188835) [Unconjugated] - Serum
Immunohistochemistry Albumin Antibody (188835) [Unconjugated] - Serum
(3 Reviews)
(54 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
Serpin
A8/Angiotensinogen An ...
NBP1-30027
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
Western Blot Serpin A8/Angiotensinogen Antibody - BSA Free
Immunohistochemistry-Paraffin Serpin A8/Angiotensinogen Antibody - BSA Free
(10 Publications)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Thyroglobulin
Antibody (904802) [Un ...
MAB8306
Immunohistochemistry Thyroglobulin Antibody (904802) [Unconjugated]
Western Blot Thyroglobulin Antibody (904802) [Unconjugated]
(1 Review)
Species: Hu
Applications: IHC, WB
MBL Antibody
AF2307
MBL Antibody
(9 Publications)
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
MBP Antibody (12)
NB600-717
Immunohistochemistry-Frozen MBP Antibody (12)
Immunohistochemistry-Frozen MBP Antibody (12)
Immunocytochemistry/ Immunofluorescence MBP Antibody (12)
(3 Reviews)
(41 Publications)
Species: Bv, Ca, Ch, Fe, Gp, Hu, Ma, Mu, Po, Rb, Rt, Sh
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI, WB
MBP-1 Antibody -
Azide and BSA Free
NBP3-04784
Western Blot MBP-1 Antibody - Azide and BSA Free
Immunohistochemistry-Paraffin MBP-1 Antibody - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence MBP-1 Antibody - Azide and BSA Free
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Pancreatic
Polypeptide/PP Antibo
NB100-1793
Flow Cytometry Pancreatic Polypeptide/PP Antibody
Immunohistochemistry-Paraffin Pancreatic Polypeptide/PP Antibody
Immunocytochemistry/ Immunofluorescence Pancreatic Polypeptide/PP Antibody
(3 Reviews)
(19 Publications)
Species: Hu, Pm, Mu, Rt
Applications: Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
Inorganic
Pyrophosphatase/PPA1
NBP1-31348
Immunocytochemistry/ Immunofluorescence Inorganic Pyrophosphatase/PPA1 Antibody
Immunohistochemistry-Paraffin Inorganic Pyrophosphatase/PPA1 Antibody
Western Blot Inorganic Pyrophosphatase/PPA1 Antibody
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
Renin Antibody
(411507) - Propeptide
MAB4447
Immunohistochemistry Renin Antibody (411507) - Propeptide
(6 Publications)
Species: Hu
Applications: IHC, WB
Vitamin D BP
Antibody [Unconjugate
AF4188
Simple Western Vitamin D BP Antibody [Unconjugated]
Western Blot Vitamin D BP Antibody [Unconjugated]
(1 Publication)
Species: Mu
Applications: Simple Western, WB
Transcobalamin II
Antibody
AF7895
Western Blot Transcobalamin II Antibody
Immunohistochemistry Transcobalamin II Antibody
Species: Hu
Applications: IHC, WB
Sialin/SLC17A5
Antibody
NBP2-20383
Immunohistochemistry-Paraffin Sialin/SLC17A5 Antibody
Western Blot Sialin/SLC17A5 Antibody
Immunocytochemistry/ Immunofluorescence Sialin/SLC17A5 Antibody
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
C-Reactive
Protein/CRP [Biotin]
DY1707
N/A C-Reactive Protein/CRP [Biotin]
(66 Publications)
Species: Hu
Applications: ELISA
RanGAP1 Antibody
(OTI1B4)
NBP2-02623
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Flow Cytometry RanGAP1 Antibody (OTI1B4)
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
SHBG [HRP]
DSHBG0B
N/A SHBG [HRP]
N/A SHBG [HRP]
N/A SHBG [HRP]
(9 Publications)
Species: Hu
Applications: ELISA
SGSM3 Antibody
NBP2-13304
Immunohistochemistry-Paraffin SGSM3 Antibody
Immunocytochemistry/ Immunofluorescence SGSM3 Antibody
Western Blot SGSM3 Antibody
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
BMAL1 Antibody
NB100-2288
Flow (Intracellular) BMAL1 Antibody
Immunohistochemistry BMAL1 Antibody
Flow Cytometry BMAL1 Antibody
(1 Review)
(66 Publications)
Species: Am, Hu, Mu, Pm, Rt
Applications: ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, KO, WB

Publications for HSD17B4 Protein (NBP1-85295PEP) (0)

There are no publications for HSD17B4 Protein (NBP1-85295PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B4 Protein (NBP1-85295PEP) (0)

There are no reviews for HSD17B4 Protein (NBP1-85295PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HSD17B4 Protein (NBP1-85295PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HSD17B4 Products

Blogs on HSD17B4

There are no specific blogs for HSD17B4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Flow (Intracellular): BMAL1 Antibody [NB100-2288] - An intracellular stain was performed on HeLa cells with NB100-2288AF647(blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
BMAL1 Antibody
NB100-2288
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human liver, lung, lymph node and testis using Anti-HSD17B4 antibody NBP1-85296 (A) shows similar protein distribution across tissues to independent antibody NBP1-85297 (B).
HSD17B4 Antibody
NBP1-85296

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HSD17B4 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol HSD17B4