![Western Blot: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Western blot analysis of extracts of various cell lines, using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-4T1W10-Western-Blot-NBP3-15368-img0007.jpg "Western Blot: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Western blot analysis of extracts of various cell lines, using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.")
| Reactivity | Hu, Mu, RtSpecies Glossary |
| Applications | WB, IHC |
| Clone | 6N7U3 |
| Clonality | Monoclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Additional Information | Recombinant Monoclonal Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HABP1/C1QBP/GC1q R (Q07021). KTLPKMSGGWELELNGTEAKLVRKVAGEKITVTFNINNSIPPTFDGEEEPSQGQKVEEQEPELTSTPNFVVEVIKNDDGKKALVLDCHYPEDEVGQEDEAE |
| Isotype | IgG |
| Clonality | Monoclonal |
| Host | Rabbit |
| Gene | C1QBP |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
| Storage | Store at -20C. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
![Simple Western CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Simple_Western_21377.jpg)
![Western Blot CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Western_Blot_21459.jpg)
![Immunohistochemistry CD44 Antibody (2C5) [Unconjugated] - s Pan Specific](https://images.novusbio.com/images2/CD44_BBA10_Immunohistochemistry_17361.jpg)
Secondary Antibodies |
Isotype Controls |
Research Areas for HABP1/C1QBP/GC1q R Antibody (NBP3-15368)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | C1QBP |
![Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded rat ovary using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-4T1W10-Immunohistochemistry-Paraffin-NBP3-15368-img0006.jpg "Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded rat ovary using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded human colon carcinoma using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-4T1W10-Immunohistochemistry-Paraffin-NBP3-15368-img0001.jpg "Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded human colon carcinoma using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded human esophageal cancer using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-4T1W10-Immunohistochemistry-Paraffin-NBP3-15368-img0002.jpg "Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded human esophageal cancer using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded mouse heart using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-4T1W10-Immunohistochemistry-Paraffin-NBP3-15368-img0003.jpg "Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded mouse heart using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded mouse kidney using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-4T1W10-Immunohistochemistry-Paraffin-NBP3-15368-img0004.jpg "Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded mouse kidney using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded rat kidney using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.](http://images.novusbio.com/fullsize/HABP1-C1QBP-GC1q-R-Antibody-4T1W10-Immunohistochemistry-Paraffin-NBP3-15368-img0005.jpg "Immunohistochemistry-Paraffin: HABP1/C1QBP/GC1q R Antibody (4T1W10) [NBP3-15368] - Immunohistochemistry of paraffin-embedded rat kidney using HABP1/C1QBP/GC1q R antibody (NBP3-15368) at dilution of 1:25 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.")
![Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded rat kidney tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15368_rabbit-habp1-c1qbp-gc1q-r-mab-6n7u3-72202512432085.jpg "Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded rat kidney tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded mouse kidney tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15368_rabbit-habp1-c1qbp-gc1q-r-mab-6n7u3-72202512432095.jpg "Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded mouse kidney tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human thyroid cancer tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15368_rabbit-habp1-c1qbp-gc1q-r-mab-6n7u3-72202512432073.jpg "Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human thyroid cancer tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human colon tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15368_rabbit-habp1-c1qbp-gc1q-r-mab-6n7u3-7220251245391.jpg "Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human colon tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human liver tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15368_rabbit-habp1-c1qbp-gc1q-r-mab-6n7u3-72202512435310.jpg "Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human liver tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human colon carcinoma tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.](http://images.novusbio.com/fullsize/nbp3-15368_rabbit-habp1-c1qbp-gc1q-r-mab-6n7u3-72202512435335.jpg "Immunohistochemistry: HABP1/C1QBP/GC1q R Antibody (6N7U3) [NBP3-15368] - Immunohistochemistry analysis of HABP1/C1QBP/GC1q R in paraffin-embedded human colon carcinoma tissue using HABP1/C1QBP/GC1q R Rabbit mAb at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.")
![C1qR1/CD93 Antibody [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "C1qR1/CD93 Antibody [Unconjugated]")
![Western Blot ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Western_Blot_5097.jpg)
![Immunohistochemistry ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Immunohistochemistry_20696.jpg)
![Knockout Validated ERK2 Antibody [Unconjugated]](https://images.novusbio.com/images2/ERK2_AF1230_Knockout_Validated_22864.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")