Novus Biologicals products are now on bio-techne.com

GTF2H2 Recombinant Protein Antigen

Images

 
There are currently no images for GTF2H2 Recombinant Protein Antigen (NBP2-56841PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

GTF2H2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GTF2H2.

Source: E. coli

Amino Acid Sequence: HVSPPPASSSSECSLIRMGFPQHTIASLSDQDAKPSFSMAHLDGNTEPGLTLGGYFCPQCRAKYCELPVECKICG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GTF2H2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-56841.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking tide related information and a protocol, click here.

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GTF2H2 Recombinant Protein Antigen

  • Basic transcription factor 2 44 kDa subunit
  • BTF2 p44
  • BTF2
  • BTF2P44TFIIH basal transcription factor complex p44 subunit
  • General transcription factor IIH polypeptide 2
  • general transcription factor IIH subunit 2
  • general transcription factor IIH, polypeptide 2 (44kD subunit)
  • general transcription factor IIH, polypeptide 2, 44kD subunit
  • general transcription factor IIH, polypeptide 2, 44kDa
  • MGC102806
  • T-BTF2P44
  • TFIIH

Background

Initiation of transcription from protein-coding genes in eukaryotes is a complex process that requires RNA polymerase II, as well as families of basal transcription factors. Binding of the factor TFIID (TBP) to the TATA box is believed to be the first step in the formation of a multiprotein complex containing several additional factors, including TFIIA, TFIIB, TFIIE, TFIIF and TFII. TFIIH (or BTF2) is a multisubunit transcription/DNA repair factor that possesses several enzymatic activities. The core of TFIIH is composed of five subunits, designated p89 (XPB or ERCC3), p62, p52, p44 and p34. Additional subunits of the TFIIH complex are p80 (XPD or ERCC2) and the ternary kinase complex composed of Cdk7, cyclin H and MAT1. Both p89 and p80 have ATP-dependent helicase activity. The p62, p52 and p44 subunits have been shown to be involved in nucleotide excision repair.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
H00008814-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, S-ELISA, WB
NBP1-88792
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
NBP1-91214
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
AF1347
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
AF8691
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
MAB17761
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-37568
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-68874
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
NBP2-00764
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
H00010598-M01
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP1-81575
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

Publications for GTF2H2 Recombinant Protein Antigen (NBP2-56841PEP) (0)

There are no publications for GTF2H2 Recombinant Protein Antigen (NBP2-56841PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GTF2H2 Recombinant Protein Antigen (NBP2-56841PEP) (0)

There are no reviews for GTF2H2 Recombinant Protein Antigen (NBP2-56841PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GTF2H2 Recombinant Protein Antigen (NBP2-56841PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GTF2H2 Products

Array NBP2-56841PEP

Research Areas for GTF2H2 Recombinant Protein Antigen (NBP2-56841PEP)

Find related products by research area.

Blogs on GTF2H2

There are no specific blogs for GTF2H2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GTF2H2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GTF2H2