![Immunohistochemistry-Paraffin: GST Epitope Tag Antibody [NBP2-14074] - Staining of human Prostate shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/GST-Epitope-Tag-Antibody-Immunohistochemistry-Paraffin-NBP2-14074-img0007.jpg "Immunohistochemistry-Paraffin: GST Epitope Tag Antibody [NBP2-14074] - Staining of human Prostate shows strong granular cytoplasmic positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MLGSLVAQLSFPGFPSIQLPYLIDGAHKITQ |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GSTM1 |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control |
|
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for GST Epitope Tag Antibody (NBP2-14074)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GSTM1 |
![Immunohistochemistry-Paraffin: GST Epitope Tag Antibody [NBP2-14074] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/GST-Epitope-Tag-Antibody-Immunohistochemistry-Paraffin-NBP2-14074-img0001.jpg "Immunohistochemistry-Paraffin: GST Epitope Tag Antibody [NBP2-14074] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.")
![Immunohistochemistry-Paraffin: GST Epitope Tag Antibody [NBP2-14074] - Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.](http://images.novusbio.com/fullsize/GST-Epitope-Tag-Antibody-Immunohistochemistry-Paraffin-NBP2-14074-img0005.jpg "Immunohistochemistry-Paraffin: GST Epitope Tag Antibody [NBP2-14074] - Staining of human Kidney shows strong granular cytoplasmic positivity in cells in tubules.")
![Immunohistochemistry-Paraffin: GST Epitope Tag Antibody [NBP2-14074] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.](http://images.novusbio.com/fullsize/GST-Epitope-Tag-Antibody-Immunohistochemistry-Paraffin-NBP2-14074-img0006.jpg "Immunohistochemistry-Paraffin: GST Epitope Tag Antibody [NBP2-14074] - Staining of human Liver shows strong granular cytoplasmic positivity in hepatocytes.")
![Immunohistochemistry-Paraffin: GST Epitope Tag Antibody [NBP2-14074] - Staining of human Small intestine shows strong granular cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize/GST-Epitope-Tag-Antibody-Immunohistochemistry-Paraffin-NBP2-14074-img0008.jpg "Immunohistochemistry-Paraffin: GST Epitope Tag Antibody [NBP2-14074] - Staining of human Small intestine shows strong granular cytoplasmic positivity in glandular cells.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")