Home » GRB2 » GRB2 Proteins » GRB2 Recombinant Protein Antigen
Novus Biologicals products are now on bio-techne.com

GRB2 Recombinant Protein Antigen

 Submit a Review

Images

 
There are currently no images for GRB2 Recombinant Protein Antigen (NBP2-55209PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Novus Biologicals is part of Bio-Techne

Shop this product on bio-techne.com

Novus Biologicals, part of Bio-Techne, offers 100% Guarantee

GRB2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to GRB2.

Source: E. coli

Amino Acid Sequence: YVQALFDFDPQEDGELGFRRGDFIHVMDNSDPNWWKGACHGQTGMFPRNYVTPVNRNV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.
Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GRB2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55209.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GRB2 Recombinant Protein Antigen

  • abundant SRC homology
  • Adapter protein GRB2
  • ASH
  • EGFRBP-GRB2
  • epidermal growth factor receptor-binding protein GRB2
  • GRB2
  • Grb3-3
  • growth factor receptor-bound protein 2
  • growth factor receptor-bound protein 3
  • HT027
  • MST084
  • MSTP084
  • NCKAP2
  • Protein Ash
  • SH2/SH3 adapter GRB2

Background

The growth factor bound protein 2 (GRB2) is a 25 kDa cytosolic protein that contains one src homology (SH2) domain and two SH3 domains (1). GRB2 associates with Tyrosine phosphorylated EGFRs and PDGFRs via its SH2 domain. GRB2 also plays a crucial role in two separate insulin pathways leading from the insulin receptor to the Ras protein thus affecting mitogenic signaling (2). Additionally GBR2, a bifunctional adaptor protein, recruits Sos for Ras activation and subsequent signal transmission (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

SHC1 Antibody
(OTI3A1)
NBP2-02434
Western Blot SHC1 Antibody (OTI3A1)
Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)
Immunohistochemistry-Paraffin SHC1 Antibody (OTI3A1)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
EGFR Antibody
[Unconjugated]
AF231
Immunohistochemistry EGFR Antibody [Unconjugated]
Immunocytochemistry EGFR Antibody [Unconjugated]
Western Blot EGFR Antibody [Unconjugated]
(30 Publications)
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ELISA(Cap), ELISA(Det), ELISA(Sta), Flow, ICC, IHC, IP, Simple Western, WB
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western Blot Src [p Tyr419] Antibody [Unconjugated]
Simple Western Src [p Tyr419] Antibody [Unconjugated]
Immunohistochemistry Src [p Tyr419] Antibody [Unconjugated]
(1 Review)
(10 Publications)
Species: Hu
Applications: IHC, Simple Western, WB
ERK2 Antibody
[Unconjugated]
AF1230
Western Blot ERK2 Antibody [Unconjugated]
Immunohistochemistry ERK2 Antibody [Unconjugated]
Knockout Validated ERK2 Antibody [Unconjugated]
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
HAI-2/SPINT2
Antibody [Unconjugate
AF1107
HAI-2/SPINT2 Antibody [Unconjugated]
(3 Publications)
Species: Mu
Applications: IHC, WB
Histatin 3
Antibody (4G9)
H00003347-M01
Sandwich ELISA Histatin 3 Antibody (4G9)
Immunocytochemistry/ Immunofluorescence Histatin 3 Antibody (4G9)
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
ERK1 Antibody
(1E5) - BSA Free
NBP2-22203
Flow Cytometry ERK1 Antibody (1E5) - BSA Free
Immunocytochemistry/ Immunofluorescence ERK1 Antibody (1E5) - BSA Free
Immunohistochemistry-Paraffin ERK1 Antibody (1E5) - BSA Free
(1 Publication)
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
EGF [Unconjugated]
236-EG
SDS-PAGE EGF [Unconjugated]
Bioactivity EGF [Unconjugated]
Cell Culture EGF [Unconjugated]
(861 Publications)
Species: Hu
Applications: BA
CD55/DAF Antibody
[Unconjugated]
AF2009
Immunohistochemistry CD55/DAF Antibody [Unconjugated]
Immunocytochemistry CD55/DAF Antibody [Unconjugated]
(8 Publications)
Species: Hu
Applications: ICC, IHC
CD21 Antibody
(SC0681)
NBP2-67605
Immunocytochemistry/ Immunofluorescence CD21 Antibody (SC0681)
Immunocytochemistry/ Immunofluorescence CD21 Antibody (SC0681)
Immunohistochemistry-Paraffin CD21 Antibody (SC0681)
(1 Publication)
Species: Hu, Pm, Mu
Applications: ICC/IF, IHC, IHC-P, IP, ISH, WB
Calretinin Antibody
NBP1-88220
Immunocytochemistry/ Immunofluorescence Calretinin Antibody
Western Blot Calretinin Antibody
Immunohistochemistry-Paraffin Calretinin Antibody
(1 Review)
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
DHRS4 Antibody
NBP2-98675
Immunohistochemistry-Paraffin DHRS4 Antibody
Immunohistochemistry-Paraffin DHRS4 Antibody
Western Blot DHRS4 Antibody
Species: Hu
Applications: IHC-P, IP, WB
CRIPTO Antibody
[Unconjugated]
AF1538
Immunocytochemistry CRIPTO Antibody [Unconjugated]
(4 Publications)
Species: Mu
Applications: Block, ICC, WB
IRS1 Antibody
NB100-82001
Immunohistochemistry-Paraffin IRS1 Antibody
Western Blot IRS1 Antibody
Immunocytochemistry/ Immunofluorescence IRS1 Antibody
(4 Publications)
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CTLA-4
[Unconjugated]
7268-CT
Bioactivity CTLA-4 [Unconjugated]
(3 Publications)
Species: Hu
Applications: BA
HLA DQ/DR/DP
Antibody (HLA-Pan/296 ...
NBP2-79843
Protein Array HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Immunocytochemistry/ Immunofluorescence HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Western Blot HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NOD2 Antibody
(2D9) - BSA Free
NB100-524
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Flow Cytometry NOD2 Antibody (2D9) - BSA Free
Immunohistochemistry-Frozen NOD2 Antibody (2D9) - BSA Free
(1 Review)
(26 Publications)
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
SOS1 Antibody
(SOS-01) - BSA Free
NB110-68800
Western Blot SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Immunocytochemistry/ Immunofluorescence SOS1 Antibody (SOS-01) - BSA Free
Species: Hu, Mu
Applications: ICC/IF, WB

Publications for GRB2 Recombinant Protein Antigen (NBP2-55209PEP) (0)

There are no publications for GRB2 Recombinant Protein Antigen (NBP2-55209PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GRB2 Recombinant Protein Antigen (NBP2-55209PEP) (0)

There are no reviews for GRB2 Recombinant Protein Antigen (NBP2-55209PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GRB2 Recombinant Protein Antigen (NBP2-55209PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GRB2 Products

Research Areas for GRB2 Recombinant Protein Antigen (NBP2-55209PEP)

Find related products by research area.

Blogs on GRB2

There are no specific blogs for GRB2, but you can read our latest blog posts.
Read our latest blog and use the new citation tool on bio-techne.com

Customers Who Bought This Also Bought

Western Blot: Recombinant Human GRB2 Protein [H00002885-P01] - Analysis of GST-GRB2 in GRB2 recombinant protein. Image from verified customer review.
Recombinant Human GRB2 GST (N-Term) Protein
H00002885-P01-10ug

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GRB2 Recombinant Protein Antigen and receive a gift card or discount.


Bioinformatics

Gene Symbol GRB2